DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31269 and AgaP_AGAP007251

DIOPT Version :9

Sequence 1:NP_001097818.1 Gene:CG31269 / 318653 FlyBaseID:FBgn0051269 Length:273 Species:Drosophila melanogaster
Sequence 2:XP_308541.4 Gene:AgaP_AGAP007251 / 1269887 VectorBaseID:AGAP007251 Length:313 Species:Anopheles gambiae


Alignment Length:288 Identity:79/288 - (27%)
Similarity:114/288 - (39%) Gaps:81/288 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 NSTDGRFYKDQRIIGGQAAEDGFAPYQISLQGISGAHS--CGGAIINETFVLTAAHCVENAFIPW 88
            |.|.|. :...||..|..|..|..|||..|....|..:  |||.::...|:|||||||   .:..
Mosquito    56 NGTHGT-HPSGRITNGLEARVGQFPYQALLLTEFGMFTIMCGGTVLTPNFILTAAHCV---MLDQ 116

  Fly    89 LVVVTG----TNKYN-------QPGGRYFLKAIHIHCNYDNPEMHNDIALLELVEPIAWDERTQP 142
            ....||    ...:|       |...|:....|.:|.:|.......|:|::.|..|:.::...||
Mosquito   117 TTKATGGMAILGAHNRMVVESTQQRIRFATSGIIVHPSYTATNFRFDVAMVRLNAPLRFNSYVQP 181

  Fly   143 IPLPL-VPMQPGDEVI--LTGWG-----------------STVL--------WGTSPIDLQVLYL 179
            :.||. ...:..|.:|  ::|:|                 :|:|        ||:..::      
Mosquito   182 VRLPARTDQRLFDGIIGTVSGFGRTNDKDGILPSILRYTINTILSNGACAARWGSLLVE------ 240

  Fly   180 QYVPHRECKALLSNDEDCDVGHICTFSRLGEGACHGDSGGPLVSN-----GYLVGLVNWGW--PC 237
               ||..|   ||.|.             |..||.|||||||...     .|.||:.::|.  .|
Mosquito   241 ---PHNIC---LSGDG-------------GRSACVGDSGGPLTIEEWGGITYQVGVTSFGSGNGC 286

  Fly   238 ATGVPDVHASVYFYRDWIRNVMSGNSKC 265
            ..|:|.|:..|.::.|||:    .||.|
Mosquito   287 TDGMPTVYGRVSYFLDWIK----ANSDC 310

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31269NP_001097818.1 Tryp_SPc 37..255 CDD:214473 71/265 (27%)
Tryp_SPc 38..258 CDD:238113 72/267 (27%)
AgaP_AGAP007251XP_308541.4 Tryp_SPc 66..304 CDD:214473 71/265 (27%)
Tryp_SPc 67..307 CDD:238113 72/271 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.