DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31269 and CLIPB7

DIOPT Version :9

Sequence 1:NP_001097818.1 Gene:CG31269 / 318653 FlyBaseID:FBgn0051269 Length:273 Species:Drosophila melanogaster
Sequence 2:XP_307910.4 Gene:CLIPB7 / 1269288 VectorBaseID:AGAP002270 Length:401 Species:Anopheles gambiae


Alignment Length:266 Identity:70/266 - (26%)
Similarity:109/266 - (40%) Gaps:60/266 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    39 IGGQAAEDGFAPYQISLQGIS--GAH--SCGGAIINETFVLTAAHCVENAFIPWLVV-------- 91
            |.|:.|:....|:.:.:|..:  |.|  .|||::|::.:|||||.|:......|.:|        
Mosquito   141 IRGELAQLFHFPWNVLIQHRTKDGEHRCHCGGSLISDRYVLTAARCIMGIKKTWTIVSVRVGELN 205

  Fly    92 ----------VTGTNKYNQPGGRYFLKAIHIHCNY---DNPEMHNDIALLELVEPIAWDERTQPI 143
                      ..|..:...|.....::.|.:..||   .:|.:..|||||.|...:.:.|...||
Mosquito   206 LQTDPDCDDSTAGVTECASPVEDIPIEKITVPSNYTGTGSPAVKQDIALLRLARRVEFSESVAPI 270

  Fly   144 PLPL-------VPMQPGDEVILTGWGSTV--------LWGTSPIDL--QVLYLQYVPHRECKALL 191
            .|||       ...:.......:|||.|.        .|....:.:  :|...:| ||       
Mosquito   271 CLPLNTSNWVGYSTEQDGSFYESGWGKTPDAAAGGDNKWNYVSVGVAREVCRDRY-PH------- 327

  Fly   192 SNDEDCDVGHICTFSRLGEGACHGDSGGPLV----SNG--YLVGLVNWGWPCA-TGVPDVHASVY 249
               ...|...||...|..:..|.||:||||:    ::|  ||:|:.::...|| .|.|.|:.:|.
Mosquito   328 ---ASIDGEQICAMPRSEQNTCRGDTGGPLMYQSGTDGAWYLMGVGSFRKQCAIVGEPAVYTNVA 389

  Fly   250 FYRDWI 255
            .:.|||
Mosquito   390 TFTDWI 395

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31269NP_001097818.1 Tryp_SPc 37..255 CDD:214473 68/264 (26%)
Tryp_SPc 38..258 CDD:238113 70/266 (26%)
CLIPB7XP_307910.4 CLIP 31..85 CDD:288855
Tryp_SPc 151..398 CDD:238113 67/256 (26%)
Tryp_SPc 151..395 CDD:214473 65/254 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.