DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31269 and AgaP_AGAP012670

DIOPT Version :9

Sequence 1:NP_001097818.1 Gene:CG31269 / 318653 FlyBaseID:FBgn0051269 Length:273 Species:Drosophila melanogaster
Sequence 2:XP_307656.4 Gene:AgaP_AGAP012670 / 1269074 VectorBaseID:AGAP012670 Length:267 Species:Anopheles gambiae


Alignment Length:260 Identity:71/260 - (27%)
Similarity:114/260 - (43%) Gaps:20/260 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSAVVLLILLGL---SGLVSITAIRIKGNSTDGRFYKDQRIIGGQAAEDGFAPYQISLQGISGAH 62
            |..|..|:|.||   |.:::..:.:.|.::..    :..||:.|:|.......|.:||: ::|..
Mosquito     1 MKQVTSLVLFGLFCGSAVLTDASDQNKPDAAS----QSGRIVNGKAVSIVKYKYALSLR-VNGVF 60

  Fly    63 SCGGAIINETFVLTAAHCV-ENAFIPWLVVVTGTNKYNQPGG-RYFLKAIHIHCNYDN---PEMH 122
            .||..||..:..||||||| :....|..|.:.|.:.....|| ...:.:|.:|.||:.   |...
Mosquito    61 DCGATIITNSHSLTAAHCVYKYPSDPSRVTLYGGSTSTSSGGIEVPVVSIALHPNYNRKGFPAAS 125

  Fly   123 N-DIALLEL-VEPIAWDERTQPIPLPLVPMQPGDEVILTGWGSTVLWGTSPID-LQVLYLQYVPH 184
            : |:|:|.: |...:......|:.|....:..|.|..:.|||.|.....:.:: |:...:..|..
Mosquito   126 DCDVAVLTVPVNSFSGRPNMAPLALQTNELPVGTECFVIGWGRTGYNQPASVNQLRYANMNIVSQ 190

  Fly   185 RECKALLSNDEDCDVGHICTFSRLGEGACHGDSGGPLVSNGYLVGLVNWGWP-CATGVPDVHASV 248
            ..|..:.:.....   .||.....|...|.|||||.||..|.|.|:|::..| |.:..|...|.:
Mosquito   191 STCATIWAEYRKF---MICAKYNNGVDTCGGDSGGALVCGGGLAGVVSFSHPNCTSAWPAGFAKI 252

  Fly   249  248
            Mosquito   253  252

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31269NP_001097818.1 Tryp_SPc 37..255 CDD:214473 63/221 (29%)
Tryp_SPc 38..258 CDD:238113 62/220 (28%)
AgaP_AGAP012670XP_307656.4 Tryp_SPc 36..254 CDD:214473 63/221 (29%)
Tryp_SPc 37..263 CDD:238113 62/220 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.