DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31269 and AgaP_AGAP012692

DIOPT Version :9

Sequence 1:NP_001097818.1 Gene:CG31269 / 318653 FlyBaseID:FBgn0051269 Length:273 Species:Drosophila melanogaster
Sequence 2:XP_307636.4 Gene:AgaP_AGAP012692 / 1269055 VectorBaseID:AGAP012692 Length:277 Species:Anopheles gambiae


Alignment Length:283 Identity:81/283 - (28%)
Similarity:123/283 - (43%) Gaps:34/283 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSAVVLL---ILLGLSGLVSITAIRIKGNST---DGRFYKDQ--------RIIGGQAAEDGFAPY 51
            |.:|:::   |.|.|.....:.:.|:..|.|   :|:..|..        ||:.|:.|.....||
Mosquito     1 MQSVMVIVGTIFLALCFTNVLASDRLVVNKTVERNGKLNKITHQSKAGLGRIVNGKNANIASYPY 65

  Fly    52 QISLQGISGAHSCGGAIINETFVLTAAHCVENAFIPWLVVVTGTNKYNQPGG-RYFLKAIHIHCN 115
            .:.|: ::.|..||.:||..|.|.|||||:.....|..:.:.|.:.....|| .:|...:.|| .
Mosquito    66 IVRLR-VNSAGVCGASIITYTHVFTAAHCLYKNQNPASITLYGGSTSQTSGGVVFFASKVIIH-P 128

  Fly   116 YDNPEMHN-DIALLELVEPIAWDERTQPIPLPLVPMQPGDEVILTGWG-STVLWGTSPIDLQVLY 178
            |.|||.|| |..::::.......:...||.|....:.........||| :.....|||.:||...
Mosquito   129 YYNPETHNYDAGIVQIKNSFQGYKNIAPIALQDAEVPSDTTCYAAGWGYNNYDRKTSPDNLQYAT 193

  Fly   179 LQYVPHRECKALLSNDEDCDVGH-----ICTFSRLGEGACHGDSGGPLVSNGYLVGLVNWGW-PC 237
            ||.:..::|.|..|       |:     ||.........|:||||||.|.|..|.|..::|. .|
Mosquito   194 LQVISPQQCSAAWS-------GYATPQFICAQQNNNGDVCNGDSGGPFVCNDKLTGATSYGGVAC 251

  Fly   238 ATGVPDVHASVY--FYRDWIRNV 258
            ...:|.....|:  ..|::||:|
Mosquito   252 RGKLPSAFTKVFAPAIREFIRSV 274

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31269NP_001097818.1 Tryp_SPc 37..255 CDD:214473 68/228 (30%)
Tryp_SPc 38..258 CDD:238113 69/230 (30%)
AgaP_AGAP012692XP_307636.4 Tryp_SPc 51..264 CDD:214473 67/221 (30%)
Tryp_SPc 52..274 CDD:238113 69/230 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.