DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31269 and AgaP_AGAP012736

DIOPT Version :9

Sequence 1:NP_001097818.1 Gene:CG31269 / 318653 FlyBaseID:FBgn0051269 Length:273 Species:Drosophila melanogaster
Sequence 2:XP_307014.4 Gene:AgaP_AGAP012736 / 1268455 VectorBaseID:AGAP012736 Length:340 Species:Anopheles gambiae


Alignment Length:242 Identity:60/242 - (24%)
Similarity:102/242 - (42%) Gaps:53/242 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    53 ISLQGISGAHSC----GGAIINE----------TFV--------LTAAHCVENAFIPWLVVVTGT 95
            :.|.|..|..||    ||.:..|          :||        :.:.:...:.::.|:.:.:..
Mosquito   108 VCLSGTGGRSSCNGDSGGPLTVESGGPIQIGVVSFVSIRGCEAGMPSVYSRVSFYLNWVEINSDF 172

  Fly    96 NKYNQPGGRYFLKAIHIHCNYDNPEMHNDIALLELVEPIAWDERTQPIPLPL---VPMQPGDEVI 157
            .:.     |:....|..|..||:..:.||:||:.|..|:.:..|.:||.||.   .....|....
Mosquito   173 QRI-----RFTSTGIRRHPEYDDTSLRNDVALILLNSPMTFTSRVKPISLPARTDTRQFEGFTGT 232

  Fly   158 LTGWGSTVLWGTSPIDLQVLYLQYVPHRECKALLSNDEDCDVG---------HICTFSRLGEGAC 213
            ::|:|.:.  ..||....:|.....|       :.:..:|.|.         ::|.....|..:|
Mosquito   233 VSGFGRSS--DASPYPSSILRFTSNP-------IMSKAECIVSWGFALAQSQNVCLKPTGGRSSC 288

  Fly   214 HGDSGGPLV--SNGYL-VGLVNWG--WPCATGVPDVHASVYFYRDWI 255
            :|||||||.  |.|.| :|.|::|  :.||:|.|.::|.|.::..||
Mosquito   289 NGDSGGPLTVNSGGVLQIGTVSFGSSYGCASGWPSMYARVSYFLSWI 335

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31269NP_001097818.1 Tryp_SPc 37..255 CDD:214473 58/240 (24%)
Tryp_SPc 38..258 CDD:238113 60/242 (25%)
AgaP_AGAP012736XP_307014.4 Tryp_SPc <7..167 CDD:238113 11/58 (19%)
Tryp_SPc <7..166 CDD:214473 10/57 (18%)
Tryp_SPc <168..335 CDD:214473 47/180 (26%)
Tryp_SPc <169..338 CDD:238113 49/181 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.