DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31269 and AgaP_AGAP012614

DIOPT Version :9

Sequence 1:NP_001097818.1 Gene:CG31269 / 318653 FlyBaseID:FBgn0051269 Length:273 Species:Drosophila melanogaster
Sequence 2:XP_306194.4 Gene:AgaP_AGAP012614 / 1267637 VectorBaseID:AGAP012614 Length:393 Species:Anopheles gambiae


Alignment Length:160 Identity:48/160 - (30%)
Similarity:69/160 - (43%) Gaps:35/160 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   112 IHCNYDNPEMH--NDIALLELVEPIAWDERTQPIPLPLVPM-----QPGDEVILTGWGSTVLWGT 169
            :|..||..:..  |||||:....|:.:.:..:||.|||...     ..|......|||.|.....
Mosquito     1 VHTGYDTKDQSNANDIALIRFTRPVNYSQTVRPICLPLSSSLRNRNHVGMPAYAAGWGKTESATA 65

  Fly   170 S----PIDLQVLYLQYVPHRECK-------ALLSNDEDCDVGHICTFSRLGEGACHGDSGGPLV- 222
            |    .:::.:..||     ||.       .||...      |:|.....|:..|.|||||||: 
Mosquito    66 SEKKLKVEMNIKSLQ-----ECAPVYQRGGILLKQT------HMCAGGVRGKDTCSGDSGGPLMR 119

  Fly   223 ---SNGYLVGLVNWG-WPCAT-GVPDVHAS 247
               .:.||:|:|::| ..|.| |||.|:.:
Mosquito   120 QMTGSWYLIGVVSFGPQKCGTFGVPGVYTN 149

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31269NP_001097818.1 Tryp_SPc 37..255 CDD:214473 48/160 (30%)
Tryp_SPc 38..258 CDD:238113 48/160 (30%)
AgaP_AGAP012614XP_306194.4 Tryp_SPc <1..149 CDD:214473 48/158 (30%)
Tryp_SPc <1..149 CDD:238113 48/158 (30%)
Tryp_SPc 261..>389 CDD:304450
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.