DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31269 and CMA1

DIOPT Version :9

Sequence 1:NP_001097818.1 Gene:CG31269 / 318653 FlyBaseID:FBgn0051269 Length:273 Species:Drosophila melanogaster
Sequence 2:NP_001827.1 Gene:CMA1 / 1215 HGNCID:2097 Length:247 Species:Homo sapiens


Alignment Length:269 Identity:74/269 - (27%)
Similarity:113/269 - (42%) Gaps:35/269 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 LILLGLSGLVSITAIRIKGNSTDGRFYKDQRIIGGQAAEDGFAPYQISLQGISG---AHSCGGAI 68
            ::||.|..|:.:...|.:..          .||||...:....||...|:.::.   :..|||.:
Human     1 MLLLPLPLLLFLLCSRAEAG----------EIIGGTECKPHSRPYMAYLEIVTSNGPSKFCGGFL 55

  Fly    69 INETFVLTAAHCVENAFIPWLVVVTGTNKYNQPGGRY----FLKAIHIHCNYDNPEMHNDIALLE 129
            |...||||||||...:    :.|..|.:...:....:    .:|... |..|:...:|:||.||:
Human    56 IRRNFVLTAAHCAGRS----ITVTLGAHNITEEEDTWQKLEVIKQFR-HPKYNTSTLHHDIMLLK 115

  Fly   130 LVEPIAWDERTQPIPLP----LVPMQPGDEVILTGWGSTVLWGTSPIDLQVLYLQYVPHRECKAL 190
            |.|..:.......:|.|    .||  ||....:.|||.|.:.......||.:.|:.:..:.|...
Human   116 LKEKASLTLAVGTLPFPSQFNFVP--PGRMCRVAGWGRTGVLKPGSDTLQEVKLRLMDPQACSHF 178

  Fly   191 LSNDEDCD--VGHICTFSRLGEGACHGDSGGPLVSNGYLVGLVNWGWPCATGVPDVHASVYFYRD 253
            ...|.:..  ||:    .|..:.|..|||||||:..|...|:|::|...|. .|.|...:..||.
Human   179 RDFDHNLQLCVGN----PRKTKSAFKGDSGGPLLCAGVAQGIVSYGRSDAK-PPAVFTRISHYRP 238

  Fly   254 WIRNVMSGN 262
            ||..::..|
Human   239 WINQILQAN 247

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31269NP_001097818.1 Tryp_SPc 37..255 CDD:214473 66/230 (29%)
Tryp_SPc 38..258 CDD:238113 68/232 (29%)
CMA1NP_001827.1 Tryp_SPc 22..243 CDD:238113 68/232 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.