DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31269 and Prss29

DIOPT Version :9

Sequence 1:NP_001097818.1 Gene:CG31269 / 318653 FlyBaseID:FBgn0051269 Length:273 Species:Drosophila melanogaster
Sequence 2:NP_444490.2 Gene:Prss29 / 114662 MGIID:2149952 Length:279 Species:Mus musculus


Alignment Length:251 Identity:78/251 - (31%)
Similarity:124/251 - (49%) Gaps:35/251 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    38 IIGGQAAEDGFAPYQISLQ-----GISGAHSCGGAIINETFVLTAAHCV-ENAFIPWLVVVTGTN 96
            |:||.:|..|..|:|:||:     .....|:|||:||:..:|||||||: |....|.:..:....
Mouse    31 IVGGHSAPQGKWPWQVSLRIYRYYWAFWVHNCGGSIIHPQWVLTAAHCIRERDADPSVFRIRVGE 95

  Fly    97 KYNQPGGRYFLKA--IHIHCNYDNPEMHNDIALLELVEPIAWDERTQPIPLPLVPMQ--PGDEVI 157
            .|.. ||:..|..  :.||.::.:..:.:|:|||:|...:......:|:.||...::  ..|...
Mouse    96 AYLY-GGKELLSVSRVIIHPDFVHAGLGSDVALLQLAVSVQSFPNVKPVKLPSESLEVTKKDVCW 159

  Fly   158 LTGWG--STVLWGTSPIDLQVLYLQYVPHRECKALLSND------------EDCDVGHICTFSRL 208
            :||||  ||......|..||.:.::.:.:..|:.:..|.            :|.    :|..:: 
Mouse   160 VTGWGAVSTHRSLPPPYRLQQVQVKIIDNSLCEEMYHNATRHRNRGQKLILKDM----LCAGNQ- 219

  Fly   209 GEGACHGDSGGPLVSN----GYLVGLVNWGWPCA-TGVPDVHASVYFYRDWIRNVM 259
            |:.:|:||||||||.|    ..|||:|:||:.|| ...|.|:|.|..:..||...|
Mouse   220 GQDSCYGDSGGPLVCNVTGSWTLVGVVSWGYGCALRDFPGVYARVQSFLPWITQQM 275

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31269NP_001097818.1 Tryp_SPc 37..255 CDD:214473 75/245 (31%)
Tryp_SPc 38..258 CDD:238113 77/248 (31%)
Prss29NP_444490.2 Tryp_SPc 31..274 CDD:238113 77/248 (31%)
Tryp_SPc 31..271 CDD:214473 75/245 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.