DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31269 and Prss28

DIOPT Version :9

Sequence 1:NP_001097818.1 Gene:CG31269 / 318653 FlyBaseID:FBgn0051269 Length:273 Species:Drosophila melanogaster
Sequence 2:NP_444489.2 Gene:Prss28 / 114661 MGIID:2149951 Length:274 Species:Mus musculus


Alignment Length:288 Identity:83/288 - (28%)
Similarity:127/288 - (44%) Gaps:52/288 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSAVVLLILLGLSGLVSITAIRIKGNSTDGRFYKDQRIIGGQAAEDGFAPYQISLQGI-----SG 60
            |..::||.|..|...|.:.::.|..:...|       |:|||....|..|:|:||:..     |.
Mouse     1 MFRLLLLALSCLESTVFMASVSISRSKPVG-------IVGGQCTPPGKWPWQVSLRMYSYEVNSW 58

  Fly    61 AHSCGGAIINETFVLTAAHCVENAFIPWLVVVTGTNKYNQPGGRYFL---------KAIHIHCNY 116
            .|.|||:||:..::||||||:::......|       |....|..:|         ..|.||.:|
Mouse    59 VHICGGSIIHPQWILTAAHCIQSQDADPAV-------YRVQVGEVYLYKEQELLNISRIIIHPDY 116

  Fly   117 DNPEMHNDIALLELVEPIAWDERTQPIPLP--LVPMQPGDEVILTGWGSTVLWGTSPIDLQVLYL 179
            ::.....|:||::|...:.......|:.||  .......|:..|.|||:.:    ..:.||..|.
Mouse   117 NDVSKRFDLALMQLTALLVTSTNVSPVSLPKDSSTFDSTDQCWLVGWGNLL----QRVPLQPPYQ 177

  Fly   180 QY---VP---HRECKALL---SNDEDCDVG----HICTFSRLGEGACHGDSGGPLV---SNGYL- 227
            .:   :|   ::.||...   |:||...|.    .:|. ...|.|.|.||||||||   ||.:: 
Mouse   178 LHEVKIPIQDNKSCKRAYRKKSSDEHKAVAIFDDMLCA-GTSGRGPCFGDSGGPLVCWKSNKWIQ 241

  Fly   228 VGLVNWGWPCATGVPDVHASVYFYRDWI 255
            ||:|:.|..|:..:|.:.:.|.....||
Mouse   242 VGVVSKGIDCSNNLPSIFSRVQSSLAWI 269

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31269NP_001097818.1 Tryp_SPc 37..255 CDD:214473 73/250 (29%)
Tryp_SPc 38..258 CDD:238113 75/251 (30%)
Prss28NP_444489.2 Tryp_SPc 31..272 CDD:238113 75/251 (30%)
Tryp_SPc 31..269 CDD:214473 73/249 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.