DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31269 and St14

DIOPT Version :9

Sequence 1:NP_001097818.1 Gene:CG31269 / 318653 FlyBaseID:FBgn0051269 Length:273 Species:Drosophila melanogaster
Sequence 2:NP_446087.1 Gene:St14 / 114093 RGDID:69288 Length:855 Species:Rattus norvegicus


Alignment Length:273 Identity:83/273 - (30%)
Similarity:130/273 - (47%) Gaps:44/273 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 KGN-STDGR------------------FYKDQRIIGGQAAEDGFAPYQISLQGISGAHSCGGAII 69
            ||| ..||:                  |.|..|::||..|::|..|:|:||..:...|.||.::|
  Rat   582 KGNPECDGKKDCSDGSDEKNCDCGLRSFTKQARVVGGTNADEGEWPWQVSLHALGQGHLCGASLI 646

  Fly    70 NETFVLTAAHCVENAFI-------PW--LVVVTGTNKYNQPG-GRYFLKAIHIHCNYDNPEMHND 124
            :..::::||||.::..|       .|  .:.:...:|.:..| ..:.||.|..|.::::.....|
  Rat   647 SPDWLVSAAHCFQDETIFKYSDHTMWTAFLGLLDQSKRSASGVQEHKLKRIITHPSFNDFTFDYD 711

  Fly   125 IALLELVEPIAWDERTQPIPLP----LVPMQPGDEVILTGWGSTVLWGTSPIDLQVLYLQYVPHR 185
            ||||||.:|..:....:||.||    :.|  .|..:.:||||.|...||..:.||...::.:...
  Rat   712 IALLELEKPAEYSTVVRPICLPDNTHVFP--AGKAIWVTGWGHTKEGGTGALILQKGEIRVINQT 774

  Fly   186 ECKALLSNDEDCDVGHICT-FSRLGEGACHGDSGGPLVS---NG--YLVGLVNWGWPCA-TGVPD 243
            .|:.||  .:......:|. |...|..:|.|||||||.|   :|  :..|:|:||..|| ...|.
  Rat   775 TCEELL--PQQITPRMMCVGFLSGGVDSCQGDSGGPLSSVEKDGRIFQAGVVSWGEGCAQRNKPG 837

  Fly   244 VHASVYFYRDWIR 256
            |:..:...||||:
  Rat   838 VYTRIPEVRDWIK 850

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31269NP_001097818.1 Tryp_SPc 37..255 CDD:214473 74/238 (31%)
Tryp_SPc 38..258 CDD:238113 75/240 (31%)
St14NP_446087.1 SEA 88..178 CDD:396113
CUB 214..332 CDD:238001
CUB 340..444 CDD:238001
LDLa 454..486 CDD:238060
LDLa 492..523 CDD:238060
LDLa 525..559 CDD:238060
LDLa 567..602 CDD:238060 5/19 (26%)
Tryp_SPc 615..852 CDD:238113 75/240 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.