DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31269 and KLK8

DIOPT Version :9

Sequence 1:NP_001097818.1 Gene:CG31269 / 318653 FlyBaseID:FBgn0051269 Length:273 Species:Drosophila melanogaster
Sequence 2:NP_653088.1 Gene:KLK8 / 11202 HGNCID:6369 Length:305 Species:Homo sapiens


Alignment Length:245 Identity:75/245 - (30%)
Similarity:117/245 - (47%) Gaps:36/245 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 KDQRIIGGQAAEDGFAPYQISL-QGISGAHSCGGAIINETFVLTAAHCVENAFIPWLVVVTGTNK 97
            ::.:::||...:....|:|.:| ||  ....|||.::...:|||||||.:    |...|..|.:.
Human    74 QEDKVLGGHECQPHSQPWQAALFQG--QQLLCGGVLVGGNWVLTAAHCKK----PKYTVRLGDHS 132

  Fly    98 -YNQPGGRYFLKAI----HIHCNYDNPEMHN-DIALLELVEPIAWDERTQPIPLPLVPMQPGDEV 156
             .|:.|....:..:    |...|..:.|.|| |:.||:|.:..:...:.:||.|.....|||.:.
Human   133 LQNKDGPEQEIPVVQSIPHPCYNSSDVEDHNHDLMLLQLRDQASLGSKVKPISLADHCTQPGQKC 197

  Fly   157 ILTGWGSTVLWGTSPID-----LQVLYLQYVPHRECKALLSNDEDCDVGHI-----CTFSRLGEG 211
            .::|||:.    |||.:     |....::..|.::|       ||...|.|     |..|..|..
Human   198 TVSGWGTV----TSPRENFPDTLNCAEVKIFPQKKC-------EDAYPGQITDGMVCAGSSKGAD 251

  Fly   212 ACHGDSGGPLVSNGYLVGLVNWGW-PCA-TGVPDVHASVYFYRDWIRNVM 259
            .|.||||||||.:|.|.|:.:||. ||. :..|.|:.::..|.|||:.::
Human   252 TCQGDSGGPLVCDGALQGITSWGSDPCGRSDKPGVYTNICRYLDWIKKII 301

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31269NP_001097818.1 Tryp_SPc 37..255 CDD:214473 73/236 (31%)
Tryp_SPc 38..258 CDD:238113 75/238 (32%)
KLK8NP_653088.1 Tryp_SPc 77..297 CDD:214473 73/236 (31%)
Tryp_SPc 78..300 CDD:238113 75/238 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165147513
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.