DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31269 and AgaP_AGAP013089

DIOPT Version :9

Sequence 1:NP_001097818.1 Gene:CG31269 / 318653 FlyBaseID:FBgn0051269 Length:273 Species:Drosophila melanogaster
Sequence 2:XP_003436251.1 Gene:AgaP_AGAP013089 / 11175918 VectorBaseID:AGAP013089 Length:634 Species:Anopheles gambiae


Alignment Length:256 Identity:75/256 - (29%)
Similarity:116/256 - (45%) Gaps:44/256 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 RIIGGQAAEDGFAPYQISLQGISGAHS------------CGGAIINETFVLTAAHCVENAFIPWL 89
            |::||..|:....|:..:|    |..|            |||.:|....|||.|||::.|.  :.
Mosquito   380 RVVGGVDAQLNAWPWMAAL----GYRSTSFELNAGPRFLCGGTLITTLHVLTVAHCIQTAL--YF 438

  Fly    90 V-----VVTGTNKYNQPGGRYFLKAIHIHCNYDNPEMHNDIALLELVEPIAWDERTQPIPLPLVP 149
            |     .:|.......|...|..:.: :|..||..:::|||||:.|.:.:...|..:||.||:..
Mosquito   439 VRLGELDITSDQDGANPVDIYIQRWV-VHERYDEKKIYNDIALVLLQKSVTITEAVRPICLPVEA 502

  Fly   150 MQPGDEV-----ILTGWGSTVLWGTSPIDLQVLYLQYVPHRECK---ALLSNDEDCDVGHICT-F 205
            .|...::     .:.|||:....|.:...||...:..:|..:|.   .|....:..|...:|. |
Mosquito   503 KQRTKDLTYYAPFIAGWGAVGYNGPTAARLQEAQVVVLPVDQCAFNYKLYFPGQIFDDTVLCAGF 567

  Fly   206 SRLGEGACHGDSGGPLV-----SNGY-----LVGLVNWGWPCA-TGVPDVHASVYFYRDWI 255
            .:.|:.:|.|||||||:     |||.     |:||:::|:.|| .|.|.|:..|..|..||
Mosquito   568 PQGGKDSCQGDSGGPLMLPELSSNGQYYYYTLIGLISYGYECARAGFPGVYVKVTAYLPWI 628

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31269NP_001097818.1 Tryp_SPc 37..255 CDD:214473 73/254 (29%)
Tryp_SPc 38..258 CDD:238113 74/255 (29%)
AgaP_AGAP013089XP_003436251.1 CLIP 250..304 CDD:288855
Tryp_SPc 380..628 CDD:214473 73/254 (29%)
Tryp_SPc 381..631 CDD:238113 74/255 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.