DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31269 and KLK11

DIOPT Version :9

Sequence 1:NP_001097818.1 Gene:CG31269 / 318653 FlyBaseID:FBgn0051269 Length:273 Species:Drosophila melanogaster
Sequence 2:XP_011524671.1 Gene:KLK11 / 11012 HGNCID:6359 Length:307 Species:Homo sapiens


Alignment Length:309 Identity:83/309 - (26%)
Similarity:127/309 - (41%) Gaps:86/309 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 VVLLILLGL-SGLVSITAIRIKGNSTDGRFYKDQRIIGGQAAEDGFAPYQISLQGISGAHSCGGA 67
            ::.||||.| :|||        |..|        |||.|...:....|:|.:|...:.. .||..
Human    35 ILQLILLALATGLV--------GGET--------RIIKGFECKPHSQPWQAALFEKTRL-LCGAT 82

  Fly    68 IINETFVLTAAHCVENAFIPWLVVV---------------------------------------- 92
            :|...::||||||::    ||:.:.                                        
Human    83 LIAPRWLLTAAHCLK----PWVSLTSPTHVSPDLSSSNYCLSHLSRYIVHLGQHNLQKEEGCEQT 143

  Fly    93 -TGTNKYNQPGGRYFLKAIHIHCNYDNPEMHNDIALLELVEPIAWDERTQPIPLPLVPMQPGDEV 156
             |.|..:..||         .:.:..|.:..|||.|:::..|::.....:|:.|....:..|...
Human   144 RTATESFPHPG---------FNNSLPNKDHRNDIMLVKMASPVSITWAVRPLTLSSRCVTAGTSC 199

  Fly   157 ILTGWGSTVLWGTS-----PIDLQVLYLQYVPHRECK-ALLSNDEDCDVGHICTFSRLGEGACHG 215
            :::|||||    :|     |..|:...:..:.|::|: |...|..|..|  ..:....|:.:|.|
Human   200 LISGWGST----SSPQLRLPHTLRCANITIIEHQKCENAYPGNITDTMV--CASVQEGGKDSCQG 258

  Fly   216 DSGGPLVSNGYLVGLVNWGW-PCA-TGVPDVHASVYFYRDWIRNVMSGN 262
            |||||||.|..|.|:::||. ||| |..|.|:..|..|.|||:..|..|
Human   259 DSGGPLVCNQSLQGIISWGQDPCAITRKPGVYTKVCKYVDWIQETMKNN 307

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31269NP_001097818.1 Tryp_SPc 37..255 CDD:214473 69/266 (26%)
Tryp_SPc 38..258 CDD:238113 70/268 (26%)
KLK11XP_011524671.1 Tryp_SPc 53..300 CDD:214473 69/266 (26%)
Tryp_SPc 54..303 CDD:238113 70/268 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.