DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31269 and LOC108647852

DIOPT Version :9

Sequence 1:NP_001097818.1 Gene:CG31269 / 318653 FlyBaseID:FBgn0051269 Length:273 Species:Drosophila melanogaster
Sequence 2:XP_017950296.2 Gene:LOC108647852 / 108647852 -ID:- Length:416 Species:Xenopus tropicalis


Alignment Length:264 Identity:76/264 - (28%)
Similarity:118/264 - (44%) Gaps:47/264 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 YKDQRIIGGQAAEDGFAPYQISLQ-----GISGAHSCGGAIINETFVLTAAHCVEN--AFIPWLV 90
            ::.:|:|.|...|.|..|:..|:|     |...|  |||.:::..:|:|||||:.:  .:.....
 Frog    39 HRVRRVIEGNTPEPGSWPWMASIQLLYKDGYGSA--CGGVLLSNRWVVTAAHCLSDLKRYRHLAR 101

  Fly    91 VVTGTNKYNQPGGRYFLKAIH---IHCNYDNPEMHNDIALLELVEPIAWDERTQPIPLPLVPMQP 152
            :|.|.....|.|....::.|.   .|.::|:....|||||:.|..|:.:.:..||..||  |...
 Frog   102 IVLGARDLTQLGPETQIRTIKQWIQHEDFDHKTHKNDIALIRLNYPVKFSDYIQPACLP--PKSS 164

  Fly   153 G----DEVILTGWGSTVLWGTSP----IDLQVLYLQYVPHRECKALLSNDEDCDVG-----HICT 204
            .    |:..:.|||   |....|    ..||...::.:..:.|     |..|...|     ::|.
 Frog   165 NVYKMDDCHIAGWG---LLNEKPRTVTTMLQEATVELIDRKRC-----NSSDWYNGGIHDDNLCA 221

  Fly   205 -FSRLGEGACHGDSGGPLVSNG------YLVGLVNWGWPCATGVP---DVHASVYFYRDWIRNVM 259
             :.:.|...|.|||||||:...      |:||:|:||..|  |.|   .|:.||..:..||.|..
 Frog   222 GYEQGGPDVCMGDSGGPLMCKRKKAGIYYVVGIVSWGGLC--GQPHSNGVYTSVQDFEQWIFNKT 284

  Fly   260 SGNS 263
            |.::
 Frog   285 SSSN 288

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31269NP_001097818.1 Tryp_SPc 37..255 CDD:214473 72/250 (29%)
Tryp_SPc 38..258 CDD:238113 73/252 (29%)
LOC108647852XP_017950296.2 Tryp_SPc 44..280 CDD:238113 71/249 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.