DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31269 and Prss48

DIOPT Version :9

Sequence 1:NP_001097818.1 Gene:CG31269 / 318653 FlyBaseID:FBgn0051269 Length:273 Species:Drosophila melanogaster
Sequence 2:XP_017446782.1 Gene:Prss48 / 108350052 RGDID:11436036 Length:308 Species:Rattus norvegicus


Alignment Length:295 Identity:92/295 - (31%)
Similarity:142/295 - (48%) Gaps:40/295 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 VVLLILLG-LSGLVSITAIRIKGNSTDGRFYKDQRIIGGQAAEDGFAPYQISLQGISGAHSCGGA 67
            |:||:||| ..|  |:|..: |..|..||.....||:|||.|..|..|:|:||: ....|.|||:
  Rat     8 VLLLLLLGAYQG--SLTKQK-KLQSVCGRPVYSGRIVGGQGAALGHWPWQVSLR-FDSTHICGGS 68

  Fly    68 IINETFVLTAAHCVENAFIPWLVVV-TGT--NKYNQPGGRYFLKAIHIHCNYDNPEMHNDIALLE 129
            :|:..:|:|||||::..:..:|..| .|:  ..|:..|..|::..|.|...:.|.:  .|||||:
  Rat    69 LISNHWVMTAAHCIKKTWFSFLYSVWLGSIDRDYSSTGEEYYVSRIVIPSKHHNTD--GDIALLK 131

  Fly   130 LVEPIAWDERTQPIPLPLV--PMQPGDEVILTGWGSTVLWGTSPIDLQVLYLQYVPHRECKAL-- 190
            |...:.:.....||.||.:  |:.......:||||.. ..|..|..||.|.:..:....|:.|  
  Rat   132 LSSRVTFTSLVLPICLPNISKPLTVPASCWVTGWGQN-QEGHYPSTLQELEVPIITGEACEQLYN 195

  Fly   191 ------------LSNDEDCDVGHICTFSRLGEGACHGDSGGPLVSN----GYLVGLVNWGWPCAT 239
                        :..|..| .|.|    :..:.:|.|||||||..:    ...:|:::||..|..
  Rat   196 PIGFFLPDLERIIKEDMLC-AGEI----QQSKDSCKGDSGGPLSCHIDGVWTQIGVISWGLECGK 255

  Fly   240 GVPDVHASVYFYRDWIRNVMS----GNSKCTGFSS 270
            .:|.|:.:|.:|:.||.:::|    ....||..:|
  Rat   256 NLPGVYTNVTYYQKWISSIISRAADWGGDCTHMAS 290

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31269NP_001097818.1 Tryp_SPc 37..255 CDD:214473 73/240 (30%)
Tryp_SPc 38..258 CDD:238113 74/242 (31%)
Prss48XP_017446782.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.