DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31269 and si:dkey-32n7.7

DIOPT Version :9

Sequence 1:NP_001097818.1 Gene:CG31269 / 318653 FlyBaseID:FBgn0051269 Length:273 Species:Drosophila melanogaster
Sequence 2:XP_021335883.1 Gene:si:dkey-32n7.7 / 108191692 ZFINID:ZDB-GENE-121214-179 Length:609 Species:Danio rerio


Alignment Length:259 Identity:83/259 - (32%)
Similarity:119/259 - (45%) Gaps:53/259 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 NSTDGRFYKDQRIIGGQAAEDGFAPYQISLQGISGAHSCGGAIINETFVLTAAHCV---ENAFIP 87
            ||::|       .:|||.:.....|:|.||...|| .:|||::||:.:||:||||.   .|.|  
Zfish   303 NSSNG-------TVGGQNSSAVHWPWQASLYWYSG-QTCGGSLINKEWVLSAAHCFNGQRNGF-- 357

  Fly    88 WLVVVTG---TNKYNQPGGRYFLKAIHIHCNYDNPEMHNDIALLELVEPIAWDERTQPIPLPLVP 149
            :|.|:.|   .|||:.......:||:..|..|:.....|||||:.|..||.:.:..:|       
Zfish   358 YLTVILGPKTQNKYDPSRISRSVKAVIKHPYYNPNTNDNDIALVRLSFPITFTDSIRP------- 415

  Fly   150 MQPGDEVILTGWGS-----TVLWGT------------SPIDLQVLYLQYVPHRECKALLSNDEDC 197
                  |.|...||     |..|.|            ||...|.:.:..:.:|:|..|.......
Zfish   416 ------VCLAAEGSVFNSDTESWITTWRNISDGVPLPSPKIFQEVEVPVIGNRQCNCLYGVGSIT 474

  Fly   198 DVGHICT-FSRLGEGACHGDSGGPLVSNGYLV----GLVNWGWPCA-TGVPDVHASVYFYRDWI 255
            | ..||. ..:.|:..|.||||||:|||...|    |:|::|..|| :..|.|:..|..|::||
Zfish   475 D-NMICAGLLKEGKDLCQGDSGGPMVSNQSSVWVQSGIVSFGSGCAQSEFPGVYTRVSRYQEWI 537

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31269NP_001097818.1 Tryp_SPc 37..255 CDD:214473 78/246 (32%)
Tryp_SPc 38..258 CDD:238113 80/247 (32%)
si:dkey-32n7.7XP_021335883.1 NIDO 4..63 CDD:310601
NIDO 141..272 CDD:322035
Tryp_SPc 309..537 CDD:238113 78/244 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.