DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31269 and LOC103908930

DIOPT Version :9

Sequence 1:NP_001097818.1 Gene:CG31269 / 318653 FlyBaseID:FBgn0051269 Length:273 Species:Drosophila melanogaster
Sequence 2:NP_001373362.1 Gene:LOC103908930 / 103908930 -ID:- Length:243 Species:Danio rerio


Alignment Length:233 Identity:81/233 - (34%)
Similarity:120/233 - (51%) Gaps:16/233 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 RIIGGQAAEDGFAPYQISLQGISGAHSCGGAIINETFVLTAAHCVENAFIPWLVVVTGTNKYN-- 99
            :||||........|:||.:.. .|...||.::|||::.::||||  |.....|.|..|  |:|  
Zfish    20 KIIGGYECPPNSQPWQIYITN-DGQRWCGASLINESWAVSAAHC--NIGANLLTVYLG--KHNID 79

  Fly   100 ---QPGGRYFLKAIHIHCNYDNPEMHNDIALLELVEPIAWDERTQPIPLPLVPMQPGDEVILTGW 161
               :...|...:.:..|..:..|...|||.|::|.:|..:::..|||||.......|::.:::||
Zfish    80 VVEKTEQRIRTEKVFPHPEFKFPSEDNDIMLIKLKDPAVFNQYVQPIPLATSCSSEGEQCLVSGW 144

  Fly   162 GSTVLWGTSPIDLQVLYLQYVPHRECKALLSNDEDCDVGHICT-FSRLGEGACHGDSGGPLVSNG 225
            |.|.:  ..|..||.|.|.....:||:.:..:....::  :|. |...|:|.||||||||||.||
Zfish   145 GYTEV--GLPSVLQCLDLAVQSRQECERVYKDKFTQNM--LCAGFMEGGKGVCHGDSGGPLVCNG 205

  Fly   226 YLVGLVNWGWPCA-TGVPDVHASVYFYRDWIRNVMSGN 262
            .|.|:|:||..|| .|.|.|:..|..|.|||...::.|
Zfish   206 ELRGVVSWGAGCAEPGYPAVYVEVCRYSDWIATTIANN 243

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31269NP_001097818.1 Tryp_SPc 37..255 CDD:214473 78/224 (35%)
Tryp_SPc 38..258 CDD:238113 80/226 (35%)
LOC103908930NP_001373362.1 Tryp_SPc 21..239 CDD:238113 80/226 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.