DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31269 and Klk15

DIOPT Version :9

Sequence 1:NP_001097818.1 Gene:CG31269 / 318653 FlyBaseID:FBgn0051269 Length:273 Species:Drosophila melanogaster
Sequence 2:XP_038952112.1 Gene:Klk15 / 102553035 RGDID:1310995 Length:169 Species:Rattus norvegicus


Alignment Length:257 Identity:63/257 - (24%)
Similarity:87/257 - (33%) Gaps:92/257 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 ILLGLSGLVSITAIRIKGNSTDGRFYKDQRIIGGQAAEDGFAPYQISLQGISGAHSCGGAIINET 72
            :||....|||.        :.||     .:::.|:.......|:|::|.. .|..:||..:|:..
  Rat     3 LLLAFILLVSA--------AQDG-----DKVLEGEECVPHSQPWQVALFE-RGRFNCGAFLISPH 53

  Fly    73 FVLTAAHCVENAFIPWLVVVTGTNKYNQPGGRYFLKAIHIHCNYDNPEMHNDIALLELVEPIAWD 137
            :||||||| :..|:...:......|::.|.....:..|..|..|:.....:||.||.|..|..  
  Rat    54 WVLTAAHC-QTRFMRVRLGEHNLRKFDGPEQLRSVSRIIPHPGYEARTHRHDIMLLRLFRPAR-- 115

  Fly   138 ERTQPIPLPLVPMQPGDEVILTGWGSTVLWGTSPIDLQVLYLQYVPHRECKALLSNDEDCDVGHI 202
                     |.|                                                     
  Rat   116 ---------LTP----------------------------------------------------- 118

  Fly   203 CTFSRLGEGACHGDSGGPLVSNGYLVGLVNWG-WPC-ATGVPDVHASVYFYRDWIRNVMSGN 262
                       .||||||||..|.|.|:|:|| .|| .|..|.|:..|..|.||||..|..|
  Rat   119 -----------QGDSGGPLVCGGALQGIVSWGDVPCDTTTKPGVYTKVCSYMDWIRKNMRRN 169

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31269NP_001097818.1 Tryp_SPc 37..255 CDD:214473 51/219 (23%)
Tryp_SPc 38..258 CDD:238113 54/221 (24%)
Klk15XP_038952112.1 Tryp_SPc 23..165 CDD:238113 54/218 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.