DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31269 and CG42694

DIOPT Version :9

Sequence 1:NP_001097818.1 Gene:CG31269 / 318653 FlyBaseID:FBgn0051269 Length:273 Species:Drosophila melanogaster
Sequence 2:NP_001188994.1 Gene:CG42694 / 10178792 FlyBaseID:FBgn0261584 Length:512 Species:Drosophila melanogaster


Alignment Length:214 Identity:52/214 - (24%)
Similarity:89/214 - (41%) Gaps:21/214 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    59 SGAH-SCGGAIINETFVLTAAHCVENAFIPWLVVVTGTNKYNQPGGRYFLKAIHIHCNYDNPEMH 122
            :|.| .|.|::|::.|||:||.|::  ....|.|..|.:...:....|.:..:.|. ::....:.
  Fly    52 NGTHVLCSGSLISKQFVLSAAQCID--VHGKLFVQLGVSNATKSPHWYTVSNVVIP-SHSGKRLQ 113

  Fly   123 NDIALLELVEPIAWDERTQPIPLPLVPMQPGDEVILTGWGSTVLWGTSPIDLQVLYLQYVPHREC 187
            .||.||:|.:.:.:::...||.:.|.........||..: :|..|.:...:.|.:.|..:....|
  Fly   114 RDIGLLKLSQSVDYNDFVYPICIALNTNTLDMVKILQNF-TTSAWLSKNKNPQTIVLSQLSRDRC 177

  Fly   188 KALLSNDEDCDVGHICTFSRLGEGACHGDSGG----PLVSNGYLV--------GLVNWGWPCATG 240
            |..||.  :.....||..|.....:|..|||.    |::....:|        |.||....|:. 
  Fly   178 KLNLSG--NVTPKEICAASLQRNNSCFIDSGSALTQPIIQGSNIVREMLFGIRGYVNGRSWCSE- 239

  Fly   241 VPDVHASVYFYRDWIRNVM 259
             |.::..|.....||..|:
  Fly   240 -PAIYIDVAECVGWIETVV 257

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31269NP_001097818.1 Tryp_SPc 37..255 CDD:214473 49/208 (24%)
Tryp_SPc 38..258 CDD:238113 51/211 (24%)
CG42694NP_001188994.1 Tryp_SPc 46..256 CDD:304450 51/211 (24%)
Tryp_SPc 46..253 CDD:214473 49/208 (24%)
Tryp_SPc 319..505 CDD:304450
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.