DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31269 and tmprss2.15

DIOPT Version :9

Sequence 1:NP_001097818.1 Gene:CG31269 / 318653 FlyBaseID:FBgn0051269 Length:273 Species:Drosophila melanogaster
Sequence 2:XP_031752206.1 Gene:tmprss2.15 / 101732233 XenbaseID:XB-GENE-22065943 Length:504 Species:Xenopus tropicalis


Alignment Length:266 Identity:80/266 - (30%)
Similarity:126/266 - (47%) Gaps:34/266 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 LVSITAIRIKGNSTDGRFYKDQRIIGGQAAEDGFAPYQISLQGISGA--HSCGGAIINETFVLTA 77
            :||:..|.. |.||.    .|.||:||..|..|..|:|:.|..:.|.  :.|||:||...:::||
 Frog   247 MVSLRCISC-GLSTK----VDSRIVGGTPASVGDWPWQVELLKLVGTSIYLCGGSIITPHWIVTA 306

  Fly    78 AHCV------ENAFIPWLVVVTGTNKYNQPGGRYFLKAIHIHCNYDNPEMHNDIALLELVEPIAW 136
            ||||      .:||..:...:|..:.|:   ..|.::...:|.:|.:.....|:|||:|...:.:
 Frog   307 AHCVYGSTSTPSAFKVFAGSLTIQSYYS---AGYTVERALVHPSYSSYTQIYDVALLKLTAALVF 368

  Fly   137 DERTQPIPLPLV--PMQPGDEVILTGWGSTVLWGTSPIDLQVLYLQYVPHRECK------ALLSN 193
            ....:|:.||.|  |...|....::|||:|...|:...:|....:..:....|.      ..:|:
 Frog   369 TTNLRPVCLPNVGMPWAEGQPCWISGWGTTAEGGSISKNLMAASVPIISSTTCNQAAVYGGAISS 433

  Fly   194 DEDCDVGHICTFSRLGEGACHGDSGGPLV----SNGYLVGLVNWGWPCATGV-PDVHASVYFYRD 253
            ...| .|::..    |...|.||||||||    |..:|||..:||:.||... |.|:.:|..:.:
 Frog   434 TMMC-AGYLSG----GTDTCQGDSGGPLVTKTNSLWWLVGDTSWGYGCARAYKPGVYGNVTVFIE 493

  Fly   254 WIRNVM 259
            ||.:.|
 Frog   494 WIYSQM 499

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31269NP_001097818.1 Tryp_SPc 37..255 CDD:214473 70/238 (29%)
Tryp_SPc 38..258 CDD:238113 71/240 (30%)
tmprss2.15XP_031752206.1 LDLa 93..121 CDD:238060
SRCR_2 164..259 CDD:406055 4/12 (33%)
Tryp_SPc 265..498 CDD:238113 71/240 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.