DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31269 and LOC101732176

DIOPT Version :9

Sequence 1:NP_001097818.1 Gene:CG31269 / 318653 FlyBaseID:FBgn0051269 Length:273 Species:Drosophila melanogaster
Sequence 2:XP_031752403.1 Gene:LOC101732176 / 101732176 -ID:- Length:516 Species:Xenopus tropicalis


Alignment Length:303 Identity:86/303 - (28%)
Similarity:138/303 - (45%) Gaps:63/303 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 LGLSGLVSITA---IRIKGNSTDGRFYK---------------------------DQRIIGGQAA 44
            ||.|.:::.::   :::|.::..|:.||                           |.||:||..|
 Frog   219 LGSSQILASSSNGYVKLKSSTVTGKLYKNLQYSATCTTGTMVSLRCINCGLSTKVDNRIVGGTFA 283

  Fly    45 EDGFAPYQISLQGISGA--HSCGGAIINETFVLTAAHCV------ENAFIPWLVVVTGTNKYNQP 101
            ..|..|:||||..:.|.  :.|||:||...:::||||||      .:.|..:...:|.:|.|:  
 Frog   284 LAGDWPWQISLMKLVGTSLYLCGGSIITPYWIVTAAHCVYGYTSSPSIFKVFAGSLTLSNYYS-- 346

  Fly   102 GGRYFLKAIHIHCNYDNPEMHNDIALLELVEPIAWDERTQPIPLPLV--PMQPGDEVILTGWGST 164
             ..|.:..:.||.:|.....:.|||||:|...:.:....:|:.||.|  |...|....::|||:|
 Frog   347 -AGYLVDRVLIHPSYSPNTQNYDIALLKLKTALVFSTNLRPVCLPNVGMPWADGQPCWISGWGTT 410

  Fly   165 VLWGTSPIDLQVLYLQYVPHRECK------ALLSNDEDCDVGHICTFSRLGEG--ACHGDSGGPL 221
            ...|:....|:...:..:....|.      .::|....| .|:      ||.|  .|.|||||||
 Frog   411 SEAGSISTSLKAASVPIISSATCNLAPVYGGVISPTMIC-AGY------LGGGTDTCQGDSGGPL 468

  Fly   222 V----SNGYLVGLVNWGWPCATGV-PDVHASVYFYRDWIRNVM 259
            |    |..:|||..:||:.||... |.|:.::..:.:||.:.|
 Frog   469 VTKTNSLWWLVGDTSWGYGCARAYKPGVYGNITVFLEWIYSQM 511

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31269NP_001097818.1 Tryp_SPc 37..255 CDD:214473 75/240 (31%)
Tryp_SPc 38..258 CDD:238113 76/242 (31%)
LOC101732176XP_031752403.1 LDLa <115..133 CDD:238060
LDLa 140..171 CDD:238060
SRCR_2 176..271 CDD:406055 7/51 (14%)
Tryp_SPc 277..510 CDD:238113 76/242 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.