DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31269 and Klk9

DIOPT Version :9

Sequence 1:NP_001097818.1 Gene:CG31269 / 318653 FlyBaseID:FBgn0051269 Length:273 Species:Drosophila melanogaster
Sequence 2:NP_082936.2 Gene:Klk9 / 101533 MGIID:1921082 Length:251 Species:Mus musculus


Alignment Length:248 Identity:73/248 - (29%)
Similarity:114/248 - (45%) Gaps:36/248 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 DQRIIGGQAAEDGFAPYQISLQGISGAHSCGGAIINETFVLTAAHCVENAFIPWLVVVTGTN--- 96
            |.|.:|.:.......|:|..|..:: ...||..:||:.::||||||.:    |:|.|..|.:   
Mouse    20 DTRAVGARECVRNSQPWQAGLFYLT-RQLCGATLINDQWLLTAAHCRK----PYLWVRLGEHHLW 79

  Fly    97 KYNQPGGRYFLKAIHIHCNYDNPEM----HN-DIALLELVEPIAWDERTQPIPLPLVPMQPGDEV 156
            ::..|.....:.....|..: ||::    || ||.|:.|...:......||:.|.......|.:.
Mouse    80 RWEGPEQLLLVTDFFPHPGF-NPDLSANDHNDDIMLIRLPRKVRLTPAVQPLNLTESRPPVGTQC 143

  Fly   157 ILTGWGSTVLWGTS----PIDLQVLYLQYVPHRECKALLSNDEDCDVGHI-----CT-FSRLGEG 211
            :::||||.   .:|    |:.||...:..:.::.|:....       |||     |. ....|.|
Mouse   144 LISGWGSV---SSSKLQYPMTLQCANISILDNKLCRWAYP-------GHISEKMLCAGLWEGGRG 198

  Fly   212 ACHGDSGGPLVSNGYLVGLVNWG-WPCA-TGVPDVHASVYFYRDWIRNVMSGN 262
            :|.||||||||..|.|.|:|:.| .||: ...|.|:.:|:.|.:||.:.|..|
Mouse   199 SCQGDSGGPLVCEGTLAGIVSGGSEPCSRPRRPAVYTNVFDYLEWIESTMEKN 251

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31269NP_001097818.1 Tryp_SPc 37..255 CDD:214473 68/237 (29%)
Tryp_SPc 38..258 CDD:238113 69/239 (29%)
Klk9NP_082936.2 Tryp_SPc 24..247 CDD:238113 69/238 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.