DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31269 and prss59.2

DIOPT Version :9

Sequence 1:NP_001097818.1 Gene:CG31269 / 318653 FlyBaseID:FBgn0051269 Length:273 Species:Drosophila melanogaster
Sequence 2:NP_001268923.1 Gene:prss59.2 / 100535672 ZFINID:ZDB-GENE-110408-10 Length:242 Species:Danio rerio


Alignment Length:270 Identity:82/270 - (30%)
Similarity:135/270 - (50%) Gaps:36/270 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSAVVLLILLGLSGLVSITAIRIKGNSTDGRFYKDQRIIGGQAAEDGFAPYQISLQGISGAHSCG 65
            |.::|.|:|||.:..:.                 |.:|:||...:....|:|.||.  ||.|.||
Zfish     1 MRSLVFLVLLGAAFALD-----------------DDKIVGGYECQPNSQPWQASLN--SGYHFCG 46

  Fly    66 GAIINETFVLTAAHCVENAFIPWLVVVTGT-NKYNQPGGRYFLKAIHI--HCNYDNPEMHNDIAL 127
            |::::|.:|::||||.::.    |.|..|. |.....|...|:.:..:  :.|||:..:.:||.|
Zfish    47 GSLVSEYWVVSAAHCYKSR----LEVRLGEHNIVINEGTEQFITSEKVIRNPNYDSWTIDSDIML 107

  Fly   128 LELVEPIAWDERTQPIPLPLVPMQPGDEVILTGWGSTVLWGTSPIDLQVLYLQYVPHRECK---- 188
            ::|.:|...::..||:.||......|....::|||:|:........||.|.:..:..|:||    
Zfish   108 IKLSKPATLNKYVQPVALPNGCAADGTMCRVSGWGNTMSSTADSNKLQCLEIPILSDRDCKNSYP 172

  Fly   189 ALLSNDEDCDVGHICTFSRLGEGACHGDSGGPLVSNGYLVGLVNWGWPCA-TGVPDVHASVYFYR 252
            .::::...| .|::    ..|:.:|.||||||:|.||.|.|:|:||:.|| ...|.|:..|..:.
Zfish   173 GMITDTMFC-AGYL----EGGKDSCQGDSGGPVVCNGELQGIVSWGYGCAQKDNPGVYGKVCMFS 232

  Fly   253 DWIRNVMSGN 262
            .||.:.|..|
Zfish   233 QWIADTMRNN 242

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31269NP_001097818.1 Tryp_SPc 37..255 CDD:214473 71/225 (32%)
Tryp_SPc 38..258 CDD:238113 73/227 (32%)
prss59.2NP_001268923.1 Tryp_SPc 20..235 CDD:214473 71/225 (32%)
Tryp_SPc 21..238 CDD:238113 73/227 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.