DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31269 and Tpsab1

DIOPT Version :9

Sequence 1:NP_001097818.1 Gene:CG31269 / 318653 FlyBaseID:FBgn0051269 Length:273 Species:Drosophila melanogaster
Sequence 2:NP_112464.4 Gene:Tpsab1 / 100503895 MGIID:96943 Length:273 Species:Mus musculus


Alignment Length:293 Identity:88/293 - (30%)
Similarity:130/293 - (44%) Gaps:62/293 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSAVVLLILLGLSGLVSITAIRIKGNSTDGRFYKDQRIIGGQAAEDGFAPYQISLQG--ISGAHS 63
            |..::||.|..||.||         ::..|.....:.|:|||.|.....|:|:||:.  ....|.
Mouse     1 MLKLLLLTLPLLSSLV---------HAAPGPAMTREGIVGGQEAHGNKWPWQVSLRANDTYWMHF 56

  Fly    64 CGGAIINETFVLTAAHCVENAFIPWLVVVTGTNKYN-QPGGRYFLKAIHI--------HCNYDNP 119
            |||::|:..:||||||||...       |...||.. |...:|.....|:        |.::...
Mouse    57 CGGSLIHPQWVLTAAHCVGPD-------VADPNKVRVQLRKQYLYYHDHLMTVSQIITHPDFYIV 114

  Fly   120 EMHNDIALLELVEPIAWDERTQPIPLPLVPMQPGDEVI-------LTGWGSTVLWGTS---PIDL 174
            :...|||||:|..|:...:...|:|||     |..|..       :||||: :..|.:   |..|
Mouse   115 QDGADIALLKLTNPVNISDYVHPVPLP-----PASETFPSGTLCWVTGWGN-IDNGVNLPPPFPL 173

  Fly   175 QVLYLQYVPHREC-----KALLSNDEDCDVGHICTFSRL-----GEGACHGDSGGPL---VSNGY 226
            :.:.:..:.:..|     |.|::.|.    .||.....|     |..:|.|||||||   |.:.:
Mouse   174 KEVQVPIIENHLCDLKYHKGLITGDN----VHIVRDDMLCAGNEGHDSCQGDSGGPLVCKVEDTW 234

  Fly   227 L-VGLVNWGWPCA-TGVPDVHASVYFYRDWIRN 257
            | .|:|:||..|| ...|.::..|.:|.|||.:
Mouse   235 LQAGVVSWGEGCAQPNRPGIYTRVTYYLDWIHH 267

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31269NP_001097818.1 Tryp_SPc 37..255 CDD:214473 77/253 (30%)
Tryp_SPc 38..258 CDD:238113 79/256 (31%)
Tpsab1NP_112464.4 Tryp_SPc 29..266 CDD:238113 78/253 (31%)
Tryp_SPc 29..265 CDD:214473 77/252 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.