DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31269 and LOC100498532

DIOPT Version :9

Sequence 1:NP_001097818.1 Gene:CG31269 / 318653 FlyBaseID:FBgn0051269 Length:273 Species:Drosophila melanogaster
Sequence 2:NP_001333498.1 Gene:LOC100498532 / 100498532 -ID:- Length:251 Species:Xenopus tropicalis


Alignment Length:238 Identity:74/238 - (31%)
Similarity:124/238 - (52%) Gaps:18/238 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 DQRIIGGQAAEDGFAPYQISLQGISGAHSCGGAIINETFVLTAAHCVENAFIPWLVVVTGTNKYN 99
            |.:|:||........|:|: |...:|.:.|||::|:..::::||||.:..  ..||.:.|.:...
 Frog    22 DDKIVGGYECTPHSQPWQV-LFTYNGGNWCGGSLISPRWIISAAHCYQPP--KTLVALLGEHDLK 83

  Fly   100 QPGG---RYFLKAIHIHCNYDNPEMHNDIALLELVEPIAWDERTQPIPLPLVPMQPGDEVILTGW 161
            :..|   ...::|.:.|..|.:....:||.|::|.:|..:::..||||:.......|.:.:::|:
 Frog    84 KKEGTEQHIQVEAAYKHFGYKDKAHDHDIMLVKLAKPAQYNQYVQPIPVARSCPTDGAKCLVSGF 148

  Fly   162 GSTVLWGTS-PIDLQVLYLQYVPHRECKA----LLSNDEDCDVGHICTFSRLGEGACHGDSGGPL 221
            |:.:.:... |..||.|.:..|....|||    ::|.:..|     ..|...|:|:|||||||||
 Frog   149 GNVLGYNVRYPDQLQCLEVPIVSDSSCKASYPRMISENMFC-----AGFLEGGKGSCHGDSGGPL 208

  Fly   222 VSNGYLVGLVNWG--WPCATGVPDVHASVYFYRDWIRNVMSGN 262
            :.||.|.|.|:||  :..:...|.|:|.|..|.|||:|:...|
 Frog   209 ICNGELYGAVSWGGSYCISKNSPGVYAKVCNYLDWIKNITENN 251

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31269NP_001097818.1 Tryp_SPc 37..255 CDD:214473 69/227 (30%)
Tryp_SPc 38..258 CDD:238113 71/229 (31%)
LOC100498532NP_001333498.1 Tryp_SPc 25..247 CDD:238113 71/229 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.