DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31269 and LOC100498083

DIOPT Version :9

Sequence 1:NP_001097818.1 Gene:CG31269 / 318653 FlyBaseID:FBgn0051269 Length:273 Species:Drosophila melanogaster
Sequence 2:XP_012810073.2 Gene:LOC100498083 / 100498083 -ID:- Length:243 Species:Xenopus tropicalis


Alignment Length:273 Identity:77/273 - (28%)
Similarity:127/273 - (46%) Gaps:41/273 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSAVVLLILLGLSGLVSITAIRIKGNSTDGRFYKDQRIIGGQAAEDGFAPYQISLQGISGAHSCG 65
            |..:::.:|||.:..                 :.|.:||||........||.:||.  :|.|.||
 Frog     1 MKLLLICVLLGAAAA-----------------FDDDKIIGGATCAKNSVPYIVSLN--AGYHFCG 46

  Fly    66 GAIINETFVLTAAHCVENAFIPWLVVVTGTNKYN---QPGGRYFLKAIHI--HCNYDNPEMHNDI 125
            |::||..:|::||||.:.:      |.....::|   ..|...|:.:..:  |..|::..:.|||
 Frog    47 GSLINNQWVVSAAHCYQAS------VQVRLGEHNIAVSEGTEQFINSAKVIRHSGYNSRTLDNDI 105

  Fly   126 ALLELVEPIAWDERTQPIPLPLVPMQPGDEVILTGWGSTVLWGTS-PIDLQVLYLQYVPHRECKA 189
            .|::|....:.:.....:.||......|...:::|||:|...|:: |..||.|....:...:|..
 Frog   106 MLIKLSSAASLNSAVNAVALPSSCAAAGTSCLISGWGNTSASGSNYPNLLQCLNAPILTTAQCSG 170

  Fly   190 L----LSNDEDCDVGHICTFSRLGEGACHGDSGGPLVSNGYLVGLVNWGWPCA-TGVPDVHASVY 249
            .    ::|:..|     ..|...|:.:|.||||||:|.||.|.|:|:||..|| ...|.|:..|.
 Frog   171 AYPGQITNNMFC-----AGFLEGGKDSCQGDSGGPVVCNGQLQGIVSWGIGCAQRNYPGVYTKVC 230

  Fly   250 FYRDWIRNVMSGN 262
            .|..||::.::.|
 Frog   231 NYNSWIQSTIAAN 243

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31269NP_001097818.1 Tryp_SPc 37..255 CDD:214473 69/228 (30%)
Tryp_SPc 38..258 CDD:238113 71/230 (31%)
LOC100498083XP_012810073.2 Tryp_SPc 21..239 CDD:238113 71/230 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.