DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31269 and tmprss2.12

DIOPT Version :9

Sequence 1:NP_001097818.1 Gene:CG31269 / 318653 FlyBaseID:FBgn0051269 Length:273 Species:Drosophila melanogaster
Sequence 2:XP_031752400.1 Gene:tmprss2.12 / 100497514 XenbaseID:XB-GENE-22065925 Length:497 Species:Xenopus tropicalis


Alignment Length:265 Identity:84/265 - (31%)
Similarity:126/265 - (47%) Gaps:37/265 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 SGL-VSITAIRIKGNSTDGRFYKDQRIIGGQAAEDGFAPYQISLQGISGAHSCGGAIINETFVLT 76
            ||| ||:..|.. |.||    |.:.||:||.:|..|..|:|::|| ....:.|||::|...:::|
 Frog   240 SGLVVSLKCIDC-GLST----YGESRIVGGSSASIGDWPWQVNLQ-YDDTNLCGGSVIAANWIVT 298

  Fly    77 AAHCVE---------NAFIPWLVVVTGTNKYNQP----GGRYFLKAIHIHCNYDNPEMHNDIALL 128
            |||||:         .|||         .|...|    ...|.:..|.:|.:|.:....|||||:
 Frog   299 AAHCVQGDTSSPSLWKAFI---------GKIKMPSYYDSSAYSVDRIIVHPDYSSQTNSNDIALM 354

  Fly   129 ELVEPIAWDERTQPIPLPLVPMQ--PGDEVILTGWGSTVLWGTSPIDLQVLYLQYVPHRECKALL 191
            :|...||:...::|:.||...||  .|....::|||:|...|:....|:...:..:....|...:
 Frog   355 KLKTSIAFSSISRPVCLPNYGMQWEEGQPCYISGWGTTSQKGSISSVLKYAMVPLISPTTCNQTI 419

  Fly   192 SNDEDCDVGHICT-FSRLGEGACHGDSGGPLV----SNGYLVGLVNWGWPCATGV-PDVHASVYF 250
            ..:.......||. :.:.|..:|.||||||||    |..:|||..:||..||... |.|:.::..
 Frog   420 MYNGAITSSMICAGYPKGGVDSCQGDSGGPLVTKTNSLWWLVGDTSWGDGCANVYRPGVYGNMTV 484

  Fly   251 YRDWI 255
            :..||
 Frog   485 FLQWI 489

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31269NP_001097818.1 Tryp_SPc 37..255 CDD:214473 72/238 (30%)
Tryp_SPc 38..258 CDD:238113 73/239 (31%)
tmprss2.12XP_031752400.1 LDLa 127..155 CDD:238060
SRCR_2 160..255 CDD:406055 7/15 (47%)
Tryp_SPc 261..489 CDD:238113 71/237 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.