DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31269 and ovch2

DIOPT Version :9

Sequence 1:NP_001097818.1 Gene:CG31269 / 318653 FlyBaseID:FBgn0051269 Length:273 Species:Drosophila melanogaster
Sequence 2:XP_031756362.1 Gene:ovch2 / 100496902 XenbaseID:XB-GENE-955935 Length:1023 Species:Xenopus tropicalis


Alignment Length:291 Identity:85/291 - (29%)
Similarity:127/291 - (43%) Gaps:52/291 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 LLGLSGLVSITAIRIKGNSTDGRF------------YKD----QRIIGGQAAEDGFAPYQISLQG 57
            ||..|.|:|:..|...|....|..            .:|    .||:||:.::.|..|:.:||:.
 Frog    19 LLVRSILLSLAVISCLGEEDPGSIRGARCGESPLGSARDLNYLSRIVGGRESKKGQHPWTVSLKR 83

  Fly    58 ISGAHSCGGAIINETFVLTAAHCVENAFI-PWLVVVTGTNKYNQ---PGGRYFLKAI----HIHC 114
             :|.|.|||.:::...||||:||:.:..: .::.|..|  :|:|   .......|.|    |...
 Frog    84 -NGKHFCGGILVSRRHVLTASHCLLDRNVKSYIRVFFG--EYDQTIKEDTEQTFKVIEIFKHPDF 145

  Fly   115 NYDNPEMHNDIALLELVEPIAWDERTQP--IPLPLVPMQPGDEVILTGWGSTVLWGTSPIDLQVL 177
            ||..| |:.|:|:|.|...:.:|:..||  :|.|....:|||..:..|||.....|..|..||.:
 Frog   146 NYTQP-MNYDVAVLVLDGAVTFDDNIQPACMPNPDDVFEPGDLCVTLGWGHLTENGILPGVLQEV 209

  Fly   178 YLQYVPHRECKALLSNDEDCDVGH--ICT-FSRLGEGACHGDSGGPLV-----SNGYLVGLVNWG 234
            .|..|....|..:::..:...|..  :|. |...|:.||.|||||||:     ....|.||.:||
 Frog   210 LLPLVNLSICLDVMATLKGAVVSSKIVCAGFPEGGKDACQGDSGGPLLCQRRHGTWVLHGLTSWG 274

  Fly   235 WPCATGVPDVHASVYFYRDWIRNV-MSGNSK 264
            ..|.             |.|..|: :..|.|
 Frog   275 MGCG-------------RSWKNNMFLPANRK 292

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31269NP_001097818.1 Tryp_SPc 37..255 CDD:214473 72/235 (31%)
Tryp_SPc 38..258 CDD:238113 72/237 (30%)
ovch2XP_031756362.1 Tryp_SPc 64..309 CDD:238113 75/246 (30%)
CUB 330..436 CDD:238001
CUB 447..558 CDD:238001
Tryp_SPc 606..832 CDD:238113
CUB 888..1000 CDD:238001
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.