DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31269 and LOC100495541

DIOPT Version :9

Sequence 1:NP_001097818.1 Gene:CG31269 / 318653 FlyBaseID:FBgn0051269 Length:273 Species:Drosophila melanogaster
Sequence 2:XP_031749237.1 Gene:LOC100495541 / 100495541 -ID:- Length:659 Species:Xenopus tropicalis


Alignment Length:256 Identity:84/256 - (32%)
Similarity:114/256 - (44%) Gaps:42/256 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 RIIGGQAAEDGFAPYQISLQGISGAHSCGGAIINETFVLTAAHCVENAFIPWLVVVTGTNKYNQP 101
            ||:||..|.||..|:|:||. ..|:|.|||::|...:::|||||.|.:..|        :.|...
 Frog   361 RIVGGTDATDGAWPWQVSLD-YHGSHICGGSLIATQWIMTAAHCFEYSKSP--------SDYKIR 416

  Fly   102 GGRYFLKAIHIH----------CNYDNPEMHN-DIALLELVEPIAWDERTQPIPLPLVP--MQPG 153
            .|.|.|..|..|          .|..|....| ||||:.|..||.:.:...||.||...  ...|
 Frog   417 LGAYQLSLISPHEITSTVDSIIVNSPNSSSTNTDIALIRLTSPITYTKYILPICLPSTSDGFTEG 481

  Fly   154 DEVILTGWGSTVLWGTS---PIDLQVLYLQYVPHRECKALLSNDEDCDV----GHICTFSRLGE- 210
            .|..:|||| |:....:   |:.||.:....:....|..:.:.|....|    ..||.....|: 
 Frog   482 MECWVTGWG-TIASQVNLPYPMTLQQVMTPLISRATCNQMYNTDSLLSVVVPLDQICAGYAAGQK 545

  Fly   211 GACHGDSGGPLVSN----GYLVGLVNWGWPCAT-GVPDVHASVYFYRDWI------RNVMS 260
            .:|.||||||||..    .|.:|:|:||..||. ..|.|:..|..|..|:      .||:|
 Frog   546 DSCQGDSGGPLVCQLQGIWYQIGIVSWGEGCAVRNRPGVYTLVPAYYSWVIAEENTNNVVS 606

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31269NP_001097818.1 Tryp_SPc 37..255 CDD:214473 80/243 (33%)
Tryp_SPc 38..258 CDD:238113 80/251 (32%)
LOC100495541XP_031749237.1 Tryp_SPc 44..283 CDD:238113
Tryp_SPc 362..595 CDD:238113 79/242 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.