DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31269 and cfb

DIOPT Version :9

Sequence 1:NP_001097818.1 Gene:CG31269 / 318653 FlyBaseID:FBgn0051269 Length:273 Species:Drosophila melanogaster
Sequence 2:XP_031747347.1 Gene:cfb / 100491419 XenbaseID:XB-GENE-479361 Length:745 Species:Xenopus tropicalis


Alignment Length:304 Identity:77/304 - (25%)
Similarity:104/304 - (34%) Gaps:121/304 - (39%)


- Green bases have known domain annotations that are detailed below.


  Fly    52 QISLQGISGAHSCGGAIINETFVLTAAHCV----ENAFIPWLVVVTGTNKYNQPGGRYFLKAIHI 112
            :|::.| |....|.|.|::..|:||||||.    :|..|..:|          .|..|.:|..:.
 Frog   479 KITISG-SSVQYCKGTILSPYFILTAAHCFHLDDKNQKIQVIV----------DGKEYPVKQPYR 532

  Fly   113 HCNYDNP----------EMHNDIALLELVEPIAWDERTQPIPLPLVPMQPGDEVILTGWGSTVLW 167
            |..| ||          ....|:.||||.:.|.:....:||.:|...             ||.  
 Frog   533 HPKY-NPISKVDKNIKRAFDYDVELLELQKKIEFSVTARPICIPCTQ-------------STA-- 581

  Fly   168 GTSPIDLQVLYLQYVPHREC----KALLSNDE----------------------------DC--- 197
                   |||   .||...|    |||||.:|                            .|   
 Frog   582 -------QVL---KVPGAPCSSHEKALLSEEEVKAIFIAEESKNPLEQKNVIIKRGSKRTACLEA 636

  Fly   198 -----------DVGHICTFSRLGEG---------ACHGDSGGPL---VSNGYL-VGLVNWGW--P 236
                       |:....|...|..|         .|.|||||||   |...|: ||:::||.  .
 Frog   637 AKKAPELKNVTDIEDAVTEQFLCTGGIEPVVDPPVCKGDSGGPLIIPVRRRYVQVGIISWGTVDH 701

  Fly   237 CATG--VPDVHASVY-FYRD------WIRNVMSGNSKCTGFSSN 271
            |..|  |...|.:.. ||:|      ||:.|:..:.:...|..|
 Frog   702 CENGKRVKQTHKNARDFYQDIFKVLPWIKKVLEESKESLTFLPN 745

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31269NP_001097818.1 Tryp_SPc 37..255 CDD:214473 72/286 (25%)
Tryp_SPc 38..258 CDD:238113 74/289 (26%)
cfbXP_031747347.1 PHA02927 <35..195 CDD:222943
vWA_complement_factors 240..442 CDD:238747
Tryp_SPc 474..732 CDD:238113 74/289 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.