DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31269 and tmprss3

DIOPT Version :9

Sequence 1:NP_001097818.1 Gene:CG31269 / 318653 FlyBaseID:FBgn0051269 Length:273 Species:Drosophila melanogaster
Sequence 2:XP_031752328.1 Gene:tmprss3 / 100490444 XenbaseID:XB-GENE-994580 Length:483 Species:Xenopus tropicalis


Alignment Length:230 Identity:73/230 - (31%)
Similarity:107/230 - (46%) Gaps:12/230 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 RIIGGQAAEDGFAPYQISLQGISGAHSCGGAIINETFVLTAAHCVENAFIP--WLVVVTGTNKYN 99
            ||:||..:..|..|:|.||. ..|.|.|||::|...:::||||||.:...|  |.|.|...::.:
 Frog   243 RIVGGNVSAVGQWPWQASLV-FQGVHLCGGSLITPQWIVTAAHCVYDLLYPEWWRVQVGQVSQAS 306

  Fly   100 QPGGRYF-LKAIHIHCNYDNPEMHNDIALLELVEPIAWDERTQPIPLP--LVPMQPGDEVILTGW 161
            :...... ::.|..|..|.:..|.|||||:.|..|..::...|||.||  ......|....::||
 Frog   307 ESAQTAVPVQKIIYHSKYRSSTMANDIALIRLASPFTFNGSIQPICLPNYREDFPEGKICWISGW 371

  Fly   162 GSTVLWGTSPIDLQVLYLQYVPHRECKALLSNDEDCDVGHICT-FSRLGEGACHGDSGGPLV--- 222
            |:|...|.:...:....:..:.:|.|..............:|. |...|...|.|||||||.   
 Frog   372 GATEEGGDTSQTMDYAGVPLISNRVCNTKYIYGGVIKPSMVCAGFLEGGVDTCQGDSGGPLACED 436

  Fly   223 SNGY-LVGLVNWGWPCATGV-PDVHASVYFYRDWI 255
            ||.: |:|..:||..||... |.|:..:..:.|||
 Frog   437 SNVWKLMGTTSWGIGCALRYKPGVYTRISSFLDWI 471

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31269NP_001097818.1 Tryp_SPc 37..255 CDD:214473 71/228 (31%)
Tryp_SPc 38..258 CDD:238113 72/229 (31%)
tmprss3XP_031752328.1 LDLa 96..128 CDD:197566
SRCR_2 136..236 CDD:406055
Tryp_SPc 244..472 CDD:238113 72/229 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.