DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31269 and tmprss6

DIOPT Version :9

Sequence 1:NP_001097818.1 Gene:CG31269 / 318653 FlyBaseID:FBgn0051269 Length:273 Species:Drosophila melanogaster
Sequence 2:XP_004913946.2 Gene:tmprss6 / 100489045 XenbaseID:XB-GENE-1011573 Length:806 Species:Xenopus tropicalis


Alignment Length:251 Identity:77/251 - (30%)
Similarity:108/251 - (43%) Gaps:45/251 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 RIIGGQAAEDGFAPYQISLQGISGAHSCGGAIINETFVLTAAHCVENAFIP--------WLVVVT 93
            |::||..|::|..|:|.||| :.|.|.|||.::.:.::||||||    |.|        |.|.:.
 Frog   570 RLVGGTQAQEGEWPWQASLQ-VRGEHICGGTLVADQWILTAAHC----FTPESYASPEVWTVYLG 629

  Fly    94 GTNKYNQPGGRYFLKAIH--IHCNYDNPEMHNDIALLEL----------VEPIAWDERTQPIPLP 146
            ..............|.|.  ||..||......|:||:.|          |:||.....|...|  
 Frog   630 KVRLSRSTQKELAFKVIRLVIHPFYDEDSHDYDVALVLLDHLVPLTSPHVQPICLPSSTHHFP-- 692

  Fly   147 LVPMQPGDEVILTGWGSTVLWGTSPIDLQVLYLQYVPHRECKALLSNDEDCDVGHICTFSRLG-E 210
                 .|....:|||||....|.:...||.:.:|.|....|..|..  .......:|...|.| :
 Frog   693 -----TGSSCWVTGWGSVKENGPTSDVLQKVDIQLVAQDICTELYR--YQISPRMLCAGYRDGSK 750

  Fly   211 GACHGDSGGPLV---SNG--YLVGLVNWGWPCATGVP---DVHASVYFYRDWIRNV 258
            .||.||||.|||   ::|  :..|||:||..|  |:|   .|::.:.....||.::
 Frog   751 DACQGDSGSPLVCKTASGRWFQAGLVSWGAGC--GIPRYFGVYSRITRLVQWIESI 804

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31269NP_001097818.1 Tryp_SPc 37..255 CDD:214473 75/246 (30%)
Tryp_SPc 38..258 CDD:238113 76/248 (31%)
tmprss6XP_004913946.2 SEA 77..176 CDD:396113
CUB 235..303 CDD:412131
LDLa 448..478 CDD:238060
LDLa 480..514 CDD:238060
LDLa 525..560 CDD:238060
Tryp_SPc 572..804 CDD:238113 76/247 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.