DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31269 and klkb1

DIOPT Version :9

Sequence 1:NP_001097818.1 Gene:CG31269 / 318653 FlyBaseID:FBgn0051269 Length:273 Species:Drosophila melanogaster
Sequence 2:XP_002934450.3 Gene:klkb1 / 100486524 XenbaseID:XB-GENE-985051 Length:629 Species:Xenopus tropicalis


Alignment Length:245 Identity:77/245 - (31%)
Similarity:118/245 - (48%) Gaps:37/245 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 RIIGGQAAEDGFAPYQIS----LQGISGAHSCGGAIINETFVLTAAHCVENAFIP--WLVV---- 91
            ||:||..:..|..|:|:|    |......|:|||:||:..:::|||||.....:|  |::.    
 Frog   390 RIVGGTDSVLGEWPWQVSMHLRLTASYKKHACGGSIISNQWIVTAAHCFAMHPLPQMWIIYSGVV 454

  Fly    92 ----VTGTNKYNQPGGRYFLKAIHIHCNYDNPEMHNDIALLELVEPIAWDERTQPIPLPLVPMQP 152
                :|.:..:::      .:.|.||.:|.......|||||:|..||::::..:.|.||  |.:|
 Frog   455 KLSNITQSTPFSE------TEQIIIHPHYTGAGNGTDIALLKLKTPISFNDHQKAICLP--PREP 511

  Fly   153 ----GDEVILTGWGSTVLWGTSPIDLQVLYLQYVPHRECKALLSNDED--CDVGHICTFSRLGE- 210
                .:...:||||.|...|:....||...:..:...||:   .|.|.  .|...:|...:.|: 
 Frog   512 TFVLPNSCWITGWGFTEESGSLANILQKAEVPQISTEECQ---GNYEQTRIDKKILCAGYKRGKI 573

  Fly   211 GACHGDSGGPLV----SNGYLVGLVNWGWPCA-TGVPDVHASVYFYRDWI 255
            .:|.|||||||.    ...||.|:.:||..|| .|.|.|:..|..:.|||
 Frog   574 DSCKGDSGGPLACVVDEIWYLTGITSWGEGCARPGKPGVYTRVSEFTDWI 623

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31269NP_001097818.1 Tryp_SPc 37..255 CDD:214473 75/243 (31%)
Tryp_SPc 38..258 CDD:238113 76/244 (31%)
klkb1XP_002934450.3 APPLE 21..103 CDD:128519
APPLE 110..193 CDD:128519
APPLE 200..283 CDD:128519
APPLE 290..373 CDD:128519
Tryp_SPc 391..626 CDD:238113 76/244 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.