DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31269 and ctsg

DIOPT Version :9

Sequence 1:NP_001097818.1 Gene:CG31269 / 318653 FlyBaseID:FBgn0051269 Length:273 Species:Drosophila melanogaster
Sequence 2:NP_001107513.1 Gene:ctsg / 100135369 XenbaseID:XB-GENE-5953471 Length:235 Species:Xenopus tropicalis


Alignment Length:231 Identity:70/231 - (30%)
Similarity:103/231 - (44%) Gaps:47/231 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    64 CGGAIINETFVLTAAHCVENAFIPW----------LVVVTGTNKYNQPGGRYFLKAIHIHC---- 114
            |||.:|:|.||||||||.|:. ..|          :||:.|.:..::.  ....:.|.: |    
 Frog    19 CGGILISEEFVLTAAHCAESQ-ASWISTKRKAYSKIVVILGAHNIDEQ--EQSQQKIGV-CEQIK 79

  Fly   115 --NYDNPEMHNDIALLELVEPIAWDERTQPIP----LPLVPMQPGDEV------ILTGWGSTVLW 167
              .|......:||.||:|::        :.:|    ||:.|.|.|.::      .:.|||....:
 Frog    80 PPEYSTQRDEHDIMLLKLMK--------KAVPNQYVLPIRPRQSGPKLEPHNLCNVAGWGRINTF 136

  Fly   168 GTSPID-LQVLYLQYVPHRECKALLS--NDEDCDVGHICTFSRLGEGACHGDSGGPLVSNGYLVG 229
            ...... ||.|.:..|...||.....  |.:.|    ||..:...:.:|.|||||||..|.||.|
 Frog   137 NDKMASKLQELNMTIVAPDECAKAFPRVNTKKC----ICAKNTDKKSSCRGDSGGPLFCNQYLHG 197

  Fly   230 LVNWGWPCATGVPDVHASVYFYRDWIRNVMSGNSKC 265
            |||.|....|| |.:..:|:.:.:||..::. |.||
 Frog   198 LVNGGNEKCTG-PRLFTNVFSHIEWINKILK-NPKC 231

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31269NP_001097818.1 Tryp_SPc 37..255 CDD:214473 65/219 (30%)
Tryp_SPc 38..258 CDD:238113 67/222 (30%)
ctsgNP_001107513.1 Tryp_SPc 1..225 CDD:238113 67/222 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.