DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31269 and gzma

DIOPT Version :9

Sequence 1:NP_001097818.1 Gene:CG31269 / 318653 FlyBaseID:FBgn0051269 Length:273 Species:Drosophila melanogaster
Sequence 2:XP_012808240.1 Gene:gzma / 100135014 XenbaseID:XB-GENE-482759 Length:267 Species:Xenopus tropicalis


Alignment Length:278 Identity:79/278 - (28%)
Similarity:115/278 - (41%) Gaps:47/278 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSAVVLLILLGLSGLVSITAIRIKGNSTDGRFYKDQRIIGGQAAEDGFAPYQISLQGISGAHSCG 65
            :|:::||             |.|.||..       ..||.|:.|.....||...:...:|  |||
 Frog    18 LSSILLL-------------IHINGNIC-------MDIIDGREAASHSRPYMAYIYSRTG--SCG 60

  Fly    66 GAIINETFVLTAAHCVENAFIPWLVVVTGTNKY----NQPGGRYFLKAIHIHCNYDNPEMHNDIA 126
            |.:|.:.:||||||||.|.    ..|:.|.:|.    |:.......:||...|.....::| ||.
 Frog    61 GTLIKQNWVLTAAHCVVNN----SEVILGAHKVKSRENEQQRFSVARAIPHPCFEWKKKIH-DIQ 120

  Fly   127 LLELVEPIAWDERTQPIPLPLVPM--QPGDEVILTGWGSTVLWGTSPID-LQVLYLQYVPHRECK 188
            ||::......::....:.||...|  :||......|||.|...|.:|.| |:.:.:..|....|.
 Frog   121 LLQIKGAAKLNKFVSVLKLPTTDMDVKPGSSCSTAGWGVTKPNGKTPSDVLREVNVTVVDRGTCN 185

  Fly   189 ALLSN-DEDCDVGHICT----FSRLGEGACHGDSGGPLVSNGYLVGLVNWGWPCATGVPDVHASV 248
            .:... ..:.....:|.    .|.....||.|||||||:......|:|::|..|  |.|. :..:
 Frog   186 KIYKKFKTEISTNMLCAGAPKKSDKKYDACQGDSGGPLICGKEFSGIVSFGKKC--GDPK-YPGI 247

  Fly   249 YF-----YRDWIRNVMSG 261
            |.     |..|||:|..|
 Frog   248 YTRLTARYLQWIRDVTGG 265

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31269NP_001097818.1 Tryp_SPc 37..255 CDD:214473 67/234 (29%)
Tryp_SPc 38..258 CDD:238113 70/236 (30%)
gzmaXP_012808240.1 Tryp_SPc 35..262 CDD:238113 70/236 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.