DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31269 and gzm3.4

DIOPT Version :9

Sequence 1:NP_001097818.1 Gene:CG31269 / 318653 FlyBaseID:FBgn0051269 Length:273 Species:Drosophila melanogaster
Sequence 2:NP_001108167.1 Gene:gzm3.4 / 100001210 ZFINID:ZDB-GENE-070912-136 Length:251 Species:Danio rerio


Alignment Length:277 Identity:77/277 - (27%)
Similarity:114/277 - (41%) Gaps:68/277 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 LVSITAIRIKGNSTDGRFYKDQRIIGGQAAEDGFAPYQISLQGISGAHSCGGAIINETFVLTAAH 79
            |:|.:.|:..|        .:..|:||:..:....||..||| :...|:|||.:|.|.:|||:||
Zfish    10 LISYSVIKTGG--------MESGIVGGREVKLHSRPYMASLQ-VQRKHNCGGILIKEDYVLTSAH 65

  Fly    80 CVENAFIPW-----LVVVTGTNKYNQPGG-------RYFLKAIHIHCNYDNPEMHNDIALLELVE 132
            |       |     |.||.|.:..:|...       :.::|    |.||.......||.||:|..
Zfish    66 C-------WKDTTNLEVVLGAHNISQRENSQQIIQVQKYIK----HPNYQKKNHSFDIMLLKLKT 119

  Fly   133 PIAWDERTQPIPLP------LVPMQPGDEVILTGWG--------STVLWGTSPIDLQVLYLQYVP 183
            ....:.......||      |.|:    |..:.|||        |.||   ..::||:....|  
Zfish   120 KAVLNHFVNITNLPKHEPSILAPV----ECSIAGWGMQRPGEGASNVL---REVNLQLESNSY-- 175

  Fly   184 HRECKA---LLSNDEDCDVGHICTFSRLGEGACHGDSGGPLVSNGYLVGLVNWGWP--CA-TGVP 242
               ||:   :..|.::.    :||.|...:..|.||||.||..|..|.|:..:.:|  |. ...|
Zfish   176 ---CKSKWQVYFNSKNM----VCTASDGKKAFCQGDSGSPLFCNSELYGMAAYTYPNNCTFKEYP 233

  Fly   243 DVHASVYFYRDWIRNVM 259
            :|:..|..:..||:..|
Zfish   234 EVYMKVSAFLPWIKKNM 250

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31269NP_001097818.1 Tryp_SPc 37..255 CDD:214473 70/249 (28%)
Tryp_SPc 38..258 CDD:238113 72/251 (29%)
gzm3.4NP_001108167.1 Tryp_SPc 25..249 CDD:238113 72/251 (29%)
Tryp_SPc 25..246 CDD:214473 70/248 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.