DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31269 and gzm3.2

DIOPT Version :9

Sequence 1:NP_001097818.1 Gene:CG31269 / 318653 FlyBaseID:FBgn0051269 Length:273 Species:Drosophila melanogaster
Sequence 2:XP_001341145.4 Gene:gzm3.2 / 100001065 ZFINID:ZDB-GENE-070912-133 Length:247 Species:Danio rerio


Alignment Length:272 Identity:76/272 - (27%)
Similarity:114/272 - (41%) Gaps:45/272 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSAVVLLILLGLSGLVSITAIRIKGNSTDGRFYKDQRIIGGQAAEDGFAPYQISLQGISGAHSCG 65
            |..::||.:..|..|.|::     |....|       |:||:.|:....||..|||. ...|.||
Zfish     1 MQYIMLLCVFLLLSLFSLS-----GGLESG-------IVGGREAKHHSRPYMASLQK-KRNHVCG 52

  Fly    66 GAIINETFVLTAAHCVENAFIPWLVVVTGTNKYNQPGGRYFLKAIHIHCNYDNPEMHNDIALLEL 130
            |.:|.|.:|||:|||........|.:|.|.:..:|......:..:..:..:    ...||.||:|
Zfish    53 GMLIKEDYVLTSAHCWNETDKYSLQIVLGAHNISQKENSQQIIQVEKYIKH----RKFDIMLLKL 113

  Fly   131 VEPIAWDERTQPIPLP------LVPMQPGDEVILTGWG-STVLWGTSPIDLQVLYLQYVPHRECK 188
            ......:.....|.||      |.|:    |..:.||| .....|.|.: |:|:.||...:.:||
Zfish   114 RTKAVLNHFVDIINLPKHEISILAPL----ECSIAGWGMKRPGEGASNV-LRVVNLQLESNAKCK 173

  Fly   189 ALLSNDEDCDVGH------ICTFSRLGEGACHGDSGGPLVSNGYLVGLVNWGWP--CA-TGVPDV 244
            :....       |      :||.|...:..|.||||.||:.|..|.|:..:.:|  |. ...|:|
Zfish   174 SKWQT-------HFNFKNMVCTVSDGKKAFCQGDSGSPLLCNSELYGMAAYTYPKNCTFKEYPEV 231

  Fly   245 HASVYFYRDWIR 256
            :..|..:..||:
Zfish   232 YMKVSAFLPWIK 243

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31269NP_001097818.1 Tryp_SPc 37..255 CDD:214473 66/233 (28%)
Tryp_SPc 38..258 CDD:238113 68/235 (29%)
gzm3.2XP_001341145.4 Tryp_SPc 26..245 CDD:238113 68/235 (29%)
Tryp_SPc 26..242 CDD:214473 66/232 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.