DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31269 and tmprss3a

DIOPT Version :9

Sequence 1:NP_001097818.1 Gene:CG31269 / 318653 FlyBaseID:FBgn0051269 Length:273 Species:Drosophila melanogaster
Sequence 2:XP_021334565.1 Gene:tmprss3a / 100000148 ZFINID:ZDB-GENE-070912-70 Length:543 Species:Danio rerio


Alignment Length:248 Identity:73/248 - (29%)
Similarity:114/248 - (45%) Gaps:13/248 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 ITAIRIKGNSTDGRFYKDQRIIGGQAAEDGFAPYQISLQGISGAHSCGGAIINETFVLTAAHCVE 82
            :||::.....:..:|  ..||:||..:.:|..|:|:||. ....|.|||:||...::|||||||.
Zfish   280 VTALKCIACGSRPKF--SARIVGGNLSAEGQFPWQVSLH-FQNEHLCGGSIITSRWILTAAHCVY 341

  Fly    83 NAFIP--WLVVVTGTNKYNQPGGRYFLKAIHIHCNYDNPEMHNDIALLELVEPIAWDERTQPIPL 145
            ....|  |:|....|.........:.::.|..|..|....:.:||||::|.:|:.::...:||.|
Zfish   342 GIAYPMYWMVYAGLTELPLNAVKAFAVEKIIYHSRYRPKGLDHDIALMKLAQPLTFNGMVEPICL 406

  Fly   146 PLV--PMQPGDEVILTGWGSTVLWGTSPIDLQVLYLQYVPHRECKALLSNDEDCDVGHICT-FSR 207
            |..  ..:.|....::|||:|...|.:.:......:..:.::.|............|.||. :..
Zfish   407 PNFGEQFEDGKMCWISGWGATEDGGDASVSQHCASVPLISNKACSQPEVYQGYLTAGMICAGYLD 471

  Fly   208 LGEGACHGDSGGPLV----SNGYLVGLVNWGWPCA-TGVPDVHASVYFYRDWI 255
            .|..:|.|||||||.    |...|||..:||..|| ...|.|:..:.....||
Zfish   472 GGTDSCQGDSGGPLACEDSSIWKLVGATSWGQGCAEKNKPGVYTRITQSLTWI 524

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31269NP_001097818.1 Tryp_SPc 37..255 CDD:214473 68/227 (30%)
Tryp_SPc 38..258 CDD:238113 69/228 (30%)
tmprss3aXP_021334565.1 LDLa 154..186 CDD:238060
SRCR_2 191..292 CDD:317845 2/11 (18%)
Tryp_SPc 298..525 CDD:238113 69/228 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.