DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31267 and Prss55

DIOPT Version :9

Sequence 1:NP_732214.1 Gene:CG31267 / 318651 FlyBaseID:FBgn0051267 Length:275 Species:Drosophila melanogaster
Sequence 2:XP_036014741.1 Gene:Prss55 / 71037 MGIID:1918287 Length:347 Species:Mus musculus


Alignment Length:281 Identity:77/281 - (27%)
Similarity:123/281 - (43%) Gaps:61/281 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 LLALSFSEASLR-----RRAFTSEKSETANKFSSRIVGGEESDVLAAPYLVSLQNAYGNHFCAGS 74
            ||.::.||..:|     |..:            |||:.|:|:::...|:.||:|.: .:|||.||
Mouse    38 LLCIASSECGVRPLYDSRIQY------------SRIIEGQEAELGEFPWQVSIQES-DHHFCGGS 89

  Fly    75 IIHDQWVITAASCLAG--LRKNNVQVVTTTYNHWGSEGWIYSVEDIVMHCNFDSPMYHNDIALIK 137
            |:.:.|::|.|.|...  |...:::|...| |...:......|..|:.|..|......|||||:.
Mouse    90 ILSEWWILTVAHCFYAQELSPTDLRVRVGT-NDLTTSPVELEVTTIIRHKGFKRLNMDNDIALLL 153

  Fly   138 THALFDYDDVTQNITI----AP------------LEDLTDGETLTMYGYGSTEIGGDFSWQLQQL 186
            ......::::|..|.:    ||            :.:.||.|::              |..|.::
Mouse   154 LAKPLTFNELTVPICLPLWPAPPSWHECWVAGWGVTNSTDKESM--------------STDLMKV 204

  Fly   187 DVTYVAPEKCNATYGGTPDLDVGHLCA-VGKVGAGACHGDTGGPIV-----DSRGRLVGVGNWGV 245
            .:..:..|:|...:   |.|....||| .|.....||.||:|||:|     .||...||:.:||.
Mouse   205 PMRIIEWEECLQMF---PSLTTNMLCASYGNESYDACQGDSGGPLVCTTDPGSRWYQVGIISWGK 266

  Fly   246 PCG-YGFPDVFARISFYYSWI 265
            .|| .|||.::..::.|..||
Mouse   267 SCGKKGFPGIYTVLAKYTLWI 287

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31267NP_732214.1 Tryp_SPc 44..265 CDD:214473 68/245 (28%)
Tryp_SPc 45..268 CDD:238113 69/246 (28%)
Prss55XP_036014741.1 Tryp_SPc 60..287 CDD:214473 68/245 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167831644
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.