DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31267 and Klk10

DIOPT Version :9

Sequence 1:NP_732214.1 Gene:CG31267 / 318651 FlyBaseID:FBgn0051267 Length:275 Species:Drosophila melanogaster
Sequence 2:NP_598473.1 Gene:Klk10 / 69540 MGIID:1916790 Length:278 Species:Mus musculus


Alignment Length:234 Identity:59/234 - (25%)
Similarity:97/234 - (41%) Gaps:46/234 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    57 PYLVSLQNAYGNHF-CAGSIIHDQWVITAASCLAGLRKNNVQVVTTTYNHWGSEGWIYSVEDIVM 120
            |:.|||  .:...| |||.::...||:|||.|.    :|.........:|.    .::..|.:  
Mouse    59 PWQVSL--FHNLQFQCAGVLVDQNWVLTAAHCW----RNKPLRARVGDDHL----LLFQKEQL-- 111

  Fly   121 HCNFDSPMYH-----------------NDIALIKTHALFDYDDVTQNI--TIAPLEDLTDGETLT 166
             .:..||::|                 :|:.::|   |.....:|.|:  ...|......|:...
Mouse   112 -RSTSSPVFHPKYQACSGPILPHRSDEHDLMMLK---LSSPVMLTSNVHPVQLPFRCSQPGQECQ 172

  Fly   167 MYGYG-STEIGGDFSWQLQQLDVTYVAPEKCNATYGGTPDLDVGHLCAVGKVGAGACHGDTGGPI 230
            :.|:| |......::..|....||.::.::|...|.|.  :....:||.......:|..|:|||:
Mouse   173 VSGWGTSASRRVKYNRSLSCSKVTLLSQKQCETFYPGV--ITNSMICAEADGNQDSCQSDSGGPL 235

  Fly   231 V--DSRGRLVGVGNWGV-PCGYG-FPDVFARISFYYSWI 265
            |  |:   |.||.:||: |||.. .|.|::.|..|..||
Mouse   236 VCDDT---LHGVLSWGIYPCGAAQHPSVYSEICKYTPWI 271

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31267NP_732214.1 Tryp_SPc 44..265 CDD:214473 57/232 (25%)
Tryp_SPc 45..268 CDD:238113 59/234 (25%)
Klk10NP_598473.1 Tryp_SPc 50..271 CDD:214473 57/232 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167831653
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.940

Return to query results.
Submit another query.