DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31267 and Prss55

DIOPT Version :9

Sequence 1:NP_732214.1 Gene:CG31267 / 318651 FlyBaseID:FBgn0051267 Length:275 Species:Drosophila melanogaster
Sequence 2:XP_008769022.1 Gene:Prss55 / 683415 RGDID:1586875 Length:321 Species:Rattus norvegicus


Alignment Length:242 Identity:71/242 - (29%)
Similarity:115/242 - (47%) Gaps:18/242 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    43 SRIVGGEESDVLAAPYLVSLQNAYGNHFCAGSIIHDQWVITAASCLAGLRKNNVQV-VTTTYNHW 106
            |||:||:|::|...|:.||:|. ..:|||.|||:.:.|::|.|.|......:..:: |....|..
  Rat    33 SRIIGGQEAEVGEFPWQVSIQE-NDHHFCGGSILSEWWILTVAHCFYSQELSPTELTVRVGTNDL 96

  Fly   107 GSEGWIYSVEDIVMHCNFDSPMYHNDIALIKTHALFDYDDVTQNITIAPLEDLTDG-ETLTMYGY 170
            .:......|.:|:.|.:|......|||||:.......:::.|..|.: ||:..... :...:.|:
  Rat    97 TTSPMELQVTNIIRHKDFKRHSMDNDIALLLLANPLTFNEQTVPICM-PLQPTPPSWQECWVAGW 160

  Fly   171 GSTEIGG--DFSWQLQQLDVTYVAPEKCNATYGGTPDLDVGHLCA-VGKVGAGACHGDTGGPIV- 231
            |:|....  ..:..|.::.:.....::|...:   |.|....||| .|.....||.||:|||:| 
  Rat   161 GTTNSADKESMNMDLMKVPMRITDWKECLQLF---PSLTTNMLCASYGNESFDACQGDSGGPLVC 222

  Fly   232 ----DSRGRLVGVGNWGVPCGY-GFPDVFARISFYYSWI--ISTING 271
                |.|...||:.:||..||. |.|.::..::.|..||  |:.|.|
  Rat   223 NQESDGRWYQVGIISWGKSCGQKGSPGIYTVLANYILWIEKITQIEG 269

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31267NP_732214.1 Tryp_SPc 44..265 CDD:214473 65/231 (28%)
Tryp_SPc 45..268 CDD:238113 67/235 (29%)
Prss55XP_008769022.1 Tryp_SPc 35..264 CDD:238113 66/233 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166335382
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.