DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31267 and 2210010C04Rik

DIOPT Version :9

Sequence 1:NP_732214.1 Gene:CG31267 / 318651 FlyBaseID:FBgn0051267 Length:275 Species:Drosophila melanogaster
Sequence 2:NP_075822.3 Gene:2210010C04Rik / 67373 MGIID:1914623 Length:247 Species:Mus musculus


Alignment Length:232 Identity:76/232 - (32%)
Similarity:118/232 - (50%) Gaps:17/232 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    44 RIVGGEESDVLAAPYLVSLQNAYGNHFCAGSIIHDQWVITAASCLAGLRKNNVQVVTTTYNHWGS 108
            :||||......|.||.|||.:.|  |||.||:|:.|||::||.|.    |:.:||....:|....
Mouse    24 KIVGGYTCQRNALPYQVSLNSGY--HFCGGSLINSQWVVSAAHCY----KSRIQVRLGEHNIDAL 82

  Fly   109 EGWIYSVE--DIVMHCNFDSPMYHNDIALIKTHALFDYDDVTQNITIAPLEDLTDGETLTMYGYG 171
            ||....::  .|:.|.|:::..|:|||.|||.......:.....:.: |....:.|....:.|:|
Mouse    83 EGGEQFIDAAKIIRHPNYNANTYNNDIMLIKLKTAATLNSRVSTVAL-PRSCPSAGTRCLVSGWG 146

  Fly   172 ST-EIGGDFSWQLQQLDVTYVAPEKCNATYGGTPDLDVGHLCAVG--KVGAGACHGDTGGPIVDS 233
            :| ..|.::...||.||...::...|.::|   |.....::..:|  :.|..:|.||:|||:| .
Mouse   147 NTLSSGTNYPSLLQCLDAPVLSDSSCTSSY---PGKITSNMFCLGFLEGGKDSCQGDSGGPVV-C 207

  Fly   234 RGRLVGVGNWGVPCGY-GFPDVFARISFYYSWIISTI 269
            .|:|.||.:||..|.. |.|.|:.::..|.:||..||
Mouse   208 NGQLQGVVSWGYGCAQRGKPGVYTKVCKYVNWIQQTI 244

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31267NP_732214.1 Tryp_SPc 44..265 CDD:214473 72/226 (32%)
Tryp_SPc 45..268 CDD:238113 74/228 (32%)
2210010C04RikNP_075822.3 Tryp_SPc 24..240 CDD:214473 72/226 (32%)
Tryp_SPc 25..243 CDD:238113 74/228 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.