DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31267 and CG17234

DIOPT Version :9

Sequence 1:NP_732214.1 Gene:CG31267 / 318651 FlyBaseID:FBgn0051267 Length:275 Species:Drosophila melanogaster
Sequence 2:NP_722785.1 Gene:CG17234 / 59225 FlyBaseID:FBgn0042187 Length:251 Species:Drosophila melanogaster


Alignment Length:275 Identity:76/275 - (27%)
Similarity:119/275 - (43%) Gaps:52/275 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 LVLLALSFSEASLRRRAFTSEKSETANKFSSRIVGGEESDVLAAPYLVSLQNAYGNHFCAGSIIH 77
            |:||||.|..|.            ..|::..||:|||...:...|:.|||| .:|:|.|.|||..
  Fly     7 LLLLALDFLSAG------------QVNRWEQRIIGGEPIGIEQVPWQVSLQ-YFGDHVCGGSIYS 58

  Fly    78 DQWVITAASCLAGLRKNNV----------QVVTTTYNHWGSEGWIYSVEDIVMHCNFDSPMYHND 132
            :..::|||.|......|.:          ..:|      .|.|.:..|..:::|..:...:..||
  Fly    59 ENIIVTAAHCFFDEEGNRLDDQGYQVRAGSALT------DSNGTLVDVAALIIHEEYAFDLNIND 117

  Fly   133 IALIKTHALFDYDDVTQNITIAPLEDLTDGETLTMYGYGSTEIGGD----FSWQLQQLDVTYVAP 193
            ||:::.....::....|.|.:|..........| :.|:|.:.|..|    :...||.|.:...:.
  Fly   118 IAIVRLSTPLEFTSKVQPIPLAKTNPYPRSIAL-VSGWGVSYILNDSTNLYPTHLQGLALHIKSI 181

  Fly   194 EKCNATYGGTPDLDVGHLCAVGKVGAGACHGDTGGPIVDSRGRLVGVGNWG----VPCGYGFPDV 254
            ..|..       .|...||| |..|..|||||:|||:|.:: :||||.:||    |...:     
  Fly   182 FSCRL-------FDPSLLCA-GTYGRTACHGDSGGPLVVNK-QLVGVVSWGRKGCVSSAF----- 232

  Fly   255 FARISFYYSWIISTI 269
            |..:.::..||::.|
  Fly   233 FVSVPYFREWILNAI 247

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31267NP_732214.1 Tryp_SPc 44..265 CDD:214473 65/238 (27%)
Tryp_SPc 45..268 CDD:238113 66/240 (28%)
CG17234NP_722785.1 Tryp_SPc 26..243 CDD:214473 65/238 (27%)
Tryp_SPc 27..243 CDD:238113 64/237 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
33.020

Return to query results.
Submit another query.