DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31267 and PRTN3

DIOPT Version :9

Sequence 1:NP_732214.1 Gene:CG31267 / 318651 FlyBaseID:FBgn0051267 Length:275 Species:Drosophila melanogaster
Sequence 2:NP_002768.3 Gene:PRTN3 / 5657 HGNCID:9495 Length:256 Species:Homo sapiens


Alignment Length:277 Identity:84/277 - (30%)
Similarity:128/277 - (46%) Gaps:57/277 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 LVLVLLALSFSEASLRRRAFTSEKSETANKFSSRIVGGEESDVLAAPYLVSLQ--NAYGNHFCAG 73
            |..|||||..|.|:   ||             :.||||.|:...:.||:.|||  ...|:|||.|
Human    10 LASVLLALLLSGAA---RA-------------AEIVGGHEAQPHSRPYMASLQMRGNPGSHFCGG 58

  Fly    74 SIIHDQWVITAASCLAGLRKNNVQVVTTTYN---------HWGSEGWIYSVEDIVMHCNFDSPMY 129
            ::||..:|:|||.||..:.:..|.||...:|         |       :||..:.:: |:|:...
Human    59 TLIHPSFVLTAAHCLRDIPQRLVNVVLGAHNVRTQEPTQQH-------FSVAQVFLN-NYDAENK 115

  Fly   130 HNDIALIKTHALFDYDDVTQNITIAPLED--LTDGETLTMYGYGSTEIGGDFSWQLQQLDVTYVA 192
            .||:.||:..:..:.......:.: |.:|  :..|......|:|........:..||:|:||.| 
Human   116 LNDVLLIQLSSPANLSASVATVQL-PQQDQPVPHGTQCLAMGWGRVGAHDPPAQVLQELNVTVV- 178

  Fly   193 PEKCNATYGGTPDLDVGHLCA-VGKVGAGACHGDTGGPIVDSRGRLVGVGN---WGVPCGYG-FP 252
                  |:...|.    ::|. |.:..||.|.||:|||:: ..|.:.|:.:   ||  |... ||
Human   179 ------TFFCRPH----NICTFVPRRKAGICFGDSGGPLI-CDGIIQGIDSFVIWG--CATRLFP 230

  Fly   253 DVFARISFYYSWIISTI 269
            |.|.|::.|..||.||:
Human   231 DFFTRVALYVDWIRSTL 247

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31267NP_732214.1 Tryp_SPc 44..265 CDD:214473 70/238 (29%)
Tryp_SPc 45..268 CDD:238113 72/240 (30%)
PRTN3NP_002768.3 Tryp_SPc 28..246 CDD:238113 72/240 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.