DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31267 and si:dkey-33m11.8

DIOPT Version :9

Sequence 1:NP_732214.1 Gene:CG31267 / 318651 FlyBaseID:FBgn0051267 Length:275 Species:Drosophila melanogaster
Sequence 2:XP_693464.3 Gene:si:dkey-33m11.8 / 565078 ZFINID:ZDB-GENE-141215-49 Length:251 Species:Danio rerio


Alignment Length:272 Identity:70/272 - (25%)
Similarity:127/272 - (46%) Gaps:53/272 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 TLVLVLLALSFSEASLRRRAFTSEKSETANKFSSRIVGGEESDVLAAPYLVSLQNAYGN-HFCAG 73
            ||:|::..|..|:                   ..||:||:|....:..|..|:|  |.| |:|.|
Zfish     8 TLLLIVSMLQGSK-------------------QQRIIGGQEVQPYSIKYQASVQ--YNNYHYCGG 51

  Fly    74 SIIHDQWVITAASCLAGLRKNN-VQVVTTTYNHWGSEGW--IYSVEDIVMHCNFDSPMYHNDIAL 135
            ::||.|||::||.|   .|.:. ::||.:.::....||:  :::|...::|..::...:.:||.|
Zfish    52 TLIHPQWVVSAAHC---WRPSYLIKVVLSEHDLSKIEGFERVFNVSKALVHYMYNYRTFDSDIML 113

  Fly   136 IKTHALFDYDDVTQNITIAP------LEDLTDGETLTMYGYGSTEIGGDFSWQ----LQQLDVTY 190
            :|..     .....:.||.|      :..|..|....:.|:|.|::   :|:.    |:.:||..
Zfish   114 LKLE-----KPAELSATIQPAVLPVSVPALQGGTVCIVSGWGVTQV---YSYYLSPVLRAVDVQI 170

  Fly   191 VAPEKCNATYGGTPDLDVGHLCAVGKVGA-GACHGDTGGPIVDSRGRLVGVGNWGVPCGYG-FPD 253
            :...:....|..|.::    :||...:|. .:|.||:|||:: ..|...|:.:||:.|... ||.
Zfish   171 IPQCQYYYYYRITDNM----VCAGSPLGGKDSCQGDSGGPLI-CNGYFEGIVSWGISCANAYFPG 230

  Fly   254 VFARISFYYSWI 265
            |:.::..|..|:
Zfish   231 VYTKVRNYIPWM 242

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31267NP_732214.1 Tryp_SPc 44..265 CDD:214473 64/236 (27%)
Tryp_SPc 45..268 CDD:238113 64/237 (27%)
si:dkey-33m11.8XP_693464.3 Tryp_SPc 23..241 CDD:214473 64/235 (27%)
Tryp_SPc 24..241 CDD:238113 63/234 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.