DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31267 and zmp:0000001088

DIOPT Version :9

Sequence 1:NP_732214.1 Gene:CG31267 / 318651 FlyBaseID:FBgn0051267 Length:275 Species:Drosophila melanogaster
Sequence 2:XP_688573.1 Gene:zmp:0000001088 / 560086 ZFINID:ZDB-GENE-140106-48 Length:263 Species:Danio rerio


Alignment Length:276 Identity:81/276 - (29%)
Similarity:130/276 - (47%) Gaps:45/276 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 LVLVLLALSFSEASLRRRAFTSEKSETANKFSSRIVGGEESDVLAAPYLVSLQNAYGNHFCAGSI 75
            ::|.:||:|..:.                 ..:|||||......:..|:||:|:|.|.|||.|::
Zfish    10 VLLEILAVSCQDV-----------------IQARIVGGYVPAPYSIKYIVSIQSATGQHFCGGTL 57

  Fly    76 IHDQWVITAASCLAGLRKNNVQVVTTTYNHWGSEGWIYSVED------IVMHCNFDSPMYHNDIA 134
            |:..||:|||.|..|  :.|:::|...|    |.|....:|.      ::.|..:|....:.||.
Zfish    58 INKYWVLTAAHCNIG--EANMRIVAGDY----SVGLYEGMEQFRRPHMLIPHPQYDRSTNNADIM 116

  Fly   135 LIKTHA---LFDYDDVTQNITIAPL--ED--LTDGETLTMYGYGSTEIGGDFSWQLQQLDVTYVA 192
            |||..:   |..|      :::.||  :|  :..|...::.|:|.|...|..|..|:.:.:..|:
Zfish   117 LIKLQSPVYLNSY------VSLVPLPRQDAMVAVGRLCSVSGWGFTTSTGGISSILRTVKLPIVS 175

  Fly   193 PEKCNATYGGTPDLDVGHLCA-VGKVGAGACHGDTGGPIVDSRGRLVGVGNWGVPCGYG-FPDVF 255
            ...||.|.....::....:|| ....|..||.||:|||:| ..||:.|:.:||..|... :|.|:
Zfish   176 TAVCNGTDSFNGNITENMICAGYSTGGKDACKGDSGGPLV-CEGRVYGIVSWGNGCADAQYPGVY 239

  Fly   256 ARISFYYSWIISTING 271
            ..:|.:..||.:||.|
Zfish   240 TAVSQFRQWIDATIFG 255

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31267NP_732214.1 Tryp_SPc 44..265 CDD:214473 72/235 (31%)
Tryp_SPc 45..268 CDD:238113 73/237 (31%)
zmp:0000001088XP_688573.1 Tryp_SPc 26..249 CDD:214473 72/235 (31%)
Tryp_SPc 27..252 CDD:238113 73/237 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.