DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31267 and LOC560023

DIOPT Version :9

Sequence 1:NP_732214.1 Gene:CG31267 / 318651 FlyBaseID:FBgn0051267 Length:275 Species:Drosophila melanogaster
Sequence 2:XP_021325702.1 Gene:LOC560023 / 560023 -ID:- Length:271 Species:Danio rerio


Alignment Length:278 Identity:83/278 - (29%)
Similarity:133/278 - (47%) Gaps:33/278 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSYQTGAVSTLVLVLLALSFSEASLRRRAFTSEKSETANKFSSRIVGGEESDVLAAPYLVSLQNA 65
            :|.....::.|:.|.|.|    |.:.|.|           ||.||:||:|....:..|.|||| .
Zfish    15 LSRSAAGMAQLLWVFLVL----AVMVRDA-----------FSQRIIGGQEVVPYSIKYQVSLQ-V 63

  Fly    66 YGNHFCAGSIIHDQWVITAASCLAGLRKNNVQVVTTTYNHWGSEGW--IYSVEDIVMHCNFDSPM 128
            ...|||.|::|..|||:|||.|..  ..:.:|||.:.:|....||:  :.:|..:..|..::...
Zfish    64 DRKHFCGGTLIQPQWVLTAAHCWR--PASVIQVVLSEHNLAVEEGFEQVCTVAKVFSHVAYNPKT 126

  Fly   129 YHNDIALIKTHALFDYDDVTQN--ITIAPLEDLTDGETLTMYGYGSTEIGGDF-SWQLQQLDVTY 190
            ::|||.:||..|....:...|.  :..|...:|..|.:.|:.|:|.|.:...: |..|:.:||..
Zfish   127 FNNDIMIIKLTAPAQINAYVQPALLPTADTPELAGGSSCTVSGWGVTRLYNFYLSPILRAVDVEI 191

  Fly   191 VAPEKCNATYGGTPDLDVGHLCAVGKVGA-GACHGDTGGPIVDSRGRLVGVGNWGVPCGYG-FPD 253
            .:  .|...|  ...::...:||..:.|. .:|.||:|||:: ..|.|.|:.:||:.|... :|.
Zfish   192 FS--SCQLYY--YYRVNDNMICAGSRFGGKDSCQGDSGGPLI-CDGYLEGIVSWGIGCALPYYPG 251

  Fly   254 VFARISFY---YSWIIST 268
            |:.::..|   ..|||||
Zfish   252 VYTKVRNYNRWIDWIIST 269

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31267NP_732214.1 Tryp_SPc 44..265 CDD:214473 68/230 (30%)
Tryp_SPc 45..268 CDD:238113 70/232 (30%)
LOC560023XP_021325702.1 Tryp_SPc 43..263 CDD:214473 68/227 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.