DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31267 and C1RL

DIOPT Version :9

Sequence 1:NP_732214.1 Gene:CG31267 / 318651 FlyBaseID:FBgn0051267 Length:275 Species:Drosophila melanogaster
Sequence 2:NP_057630.2 Gene:C1RL / 51279 HGNCID:21265 Length:487 Species:Homo sapiens


Alignment Length:229 Identity:63/229 - (27%)
Similarity:100/229 - (43%) Gaps:43/229 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    73 GSIIHDQWVITAASCL-----AGLRKNNVQVVTTTYNHWGSEGWI----YSVEDIVMHCNFDSPM 128
            |:::.|:|::|||..:     ..||||  |.|.....|...:..:    :.|..:|:|.::....
Human   270 GALLGDRWILTAAHTIYPKDSVSLRKN--QSVNVFLGHTAIDEMLKLGNHPVHRVVVHPDYRQNE 332

  Fly   129 YHN---DIALIKTHALFDYDDVTQNITIAP---LEDLTDGETL---TMYGYGSTEIGGDFSWQLQ 184
            .||   ||||:         ::..:|.:.|   ...|.|.|||   .:.||.| ..|.:..|...
Human   333 SHNFSGDIALL---------ELQHSIPLGPNVLPVCLPDNETLYRSGLLGYVS-GFGMEMGWLTT 387

  Fly   185 QLDVTY--VAP-EKCNA--TYGGTPDLDVGHLCAVGKVGA--GACHGDTGGPIV--DSRGR---L 237
            :|..:.  ||| |.|||  .....|::...::..||....  ..|.||:|...|  |:...   .
Human   388 ELKYSRLPVAPREACNAWLQKRQRPEVFSDNMFCVGDETQRHSVCQGDSGSVYVVWDNHAHHWVA 452

  Fly   238 VGVGNWGVPCGYGFPDVFARISFYYSWIISTING 271
            .|:.:||:.||.|: |.:.::..|..||...:||
Human   453 TGIVSWGIGCGEGY-DFYTKVLSYVDWIKGVMNG 485

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31267NP_732214.1 Tryp_SPc 44..265 CDD:214473 59/221 (27%)
Tryp_SPc 45..268 CDD:238113 61/224 (27%)
C1RLNP_057630.2 CUB 40..162 CDD:238001
Tryp_SPc 247..480 CDD:238113 60/222 (27%)
Tryp_SPc 247..479 CDD:214473 59/221 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165141691
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.