DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31267 and Elane

DIOPT Version :9

Sequence 1:NP_732214.1 Gene:CG31267 / 318651 FlyBaseID:FBgn0051267 Length:275 Species:Drosophila melanogaster
Sequence 2:NP_056594.2 Gene:Elane / 50701 MGIID:2679229 Length:265 Species:Mus musculus


Alignment Length:278 Identity:82/278 - (29%)
Similarity:119/278 - (42%) Gaps:59/278 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 TLVLVLLALSFSEASLRRRAFTSEKSETANKFSSRIVGGEESDVLAAPYLVSLQNAYGNHFCAGS 74
            ||..:||||.....:|                :|.||||..:...|.|::.|||.. |.|||..:
Mouse    10 TLAAMLLALFLGGPAL----------------ASEIVGGRPARPHAWPFMASLQRR-GGHFCGAT 57

  Fly    75 IIHDQWVITAASCLAGLRKNNVQVVTTTYNHWGSE--GWIYSVEDIVMHCNFDSPMYHNDIALIK 137
            :|...:|::||.|:.||...:||||...::....|  ...:||:.|..: .||.....|||.:|:
Mouse    58 LIARNFVMSAAHCVNGLNFRSVQVVLGAHDLRRQERTRQTFSVQRIFEN-GFDPSQLLNDIVIIQ 121

  Fly   138 THALFDYDDVTQNITIAPL----EDLTDGETLTMYGYGSTEIGGDFSWQLQQLDVTYVAPEKCNA 198
               |.....:..|:.:|.|    :.:.|.......|:|...........||:|:|| |....|..
Mouse   122 ---LNGSATINANVQVAQLPAQGQGVGDRTPCLAMGWGRLGTNRPSPSVLQELNVT-VVTNMCRR 182

  Fly   199 TYGGTPDLDVGHLCA-VGKVGAGACHGDTGGPIV--------DS--RGRLVGVGNWGVPCGYG-F 251
            ..         ::|. |.:..||.|.||:|||:|        ||  ||          .||.| :
Mouse   183 RV---------NVCTLVPRRQAGICFGDSGGPLVCNNLVQGIDSFIRG----------GCGSGLY 228

  Fly   252 PDVFARISFYYSWIISTI 269
            ||.||.::.:..||.|.|
Mouse   229 PDAFAPVAEFADWINSII 246

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31267NP_732214.1 Tryp_SPc 44..265 CDD:214473 70/238 (29%)
Tryp_SPc 45..268 CDD:238113 72/240 (30%)
ElaneNP_056594.2 Tryp_SPc 28..242 CDD:214473 70/238 (29%)
Tryp_SPc 29..245 CDD:238113 72/240 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.