DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31267 and Prss53

DIOPT Version :9

Sequence 1:NP_732214.1 Gene:CG31267 / 318651 FlyBaseID:FBgn0051267 Length:275 Species:Drosophila melanogaster
Sequence 2:XP_006230384.1 Gene:Prss53 / 499270 RGDID:1566127 Length:591 Species:Rattus norvegicus


Alignment Length:286 Identity:69/286 - (24%)
Similarity:113/286 - (39%) Gaps:70/286 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 SFSEASLRRRAF----------TSEKSETA-NKFSSRIVGGEESDVLAA-PYLVSLQNAYGNHFC 71
            |:.:|.:.|.||          :.|.|..| ...||   ||.::..|:. |:...|:: :|...|
  Rat   305 SWLQAHVDRAAFLVQDPGVVKMSDENSCVACGSLSS---GGPQAGALSQWPWDARLKH-HGKLAC 365

  Fly    72 AGSIIHDQWVITAASCLAGLRKNNVQVVTTTYNHW------GSEGWIYSVEDIVMHCNFDSPMYH 130
            .|:::.:..|:|||.|..|.:         |...|      |.|.|  .::.:::|..:..|...
  Rat   366 GGALVSEVVVLTAAHCFIGRQ---------TLEEWSVGLGAGPEEW--GLKQLILHGAYTHPEGG 419

  Fly   131 NDIALIKTHALFDYDDVTQNITIAPLEDLTDGETLTMYGYGSTEI-GGDFSWQL----------- 183
            :|:|.:.         :.|.:|:.|      |.......|....: .|:..|.|           
  Rat   420 HDVAFLL---------LAQPVTLGP------GLRPLCLPYADHRLPDGEHGWVLGLTREAGINHP 469

  Fly   184 QQLDVTYVAPEKCNATYG-----GTPDLDVGHLCAVGKVGAGACHGDTGGPIV-DSRGR--LVGV 240
            ..:.||.:.|..|:..:.     |.|.|. |.:|.........|.|.:|.|:| :.||.  |.|:
  Rat   470 HTVPVTVLGPMACSRQHAASGSTGVPILP-GMICTTVVGEPPHCEGLSGAPLVHEIRGTWFLAGL 533

  Fly   241 GNWGVPC-GYGFPDVFARISFYYSWI 265
            .::|..| |...|.|||.:|.|..|:
  Rat   534 HSFGDTCQGSAKPAVFAALSAYEDWV 559

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31267NP_732214.1 Tryp_SPc 44..265 CDD:214473 58/248 (23%)
Tryp_SPc 45..268 CDD:238113 59/249 (24%)
Prss53XP_006230384.1 Tryp_SPc 45..310 CDD:238113 1/4 (25%)
Tryp_SPc 341..561 CDD:238113 59/247 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24276
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.